KEGG   Escherichia blattae DSM 4481: EBL_c08110Help
Entry
EBL_c08110        CDS       T02111                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ebt  Escherichia blattae DSM 4481
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ebt03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
824825..826672
Genome map
AA seq 615 aa AA seqDB search
MSIRALLQDAVACRWLRALDAQFAMMIAGEQQPALMLAAALVSRDAGEGHVCVPLARLAP
DHIDAGAQRPLVEALFQAAGQPEDWQQQLLDSPAVSQGEEATPLKLHAGRLYLNRMWQYE
RRVAQFFAEQNQALAVDPQALAGVLDKLFAPQPDTDWQKVAAAVALTRRIAVISGGPGTG
KTTTVAKLLAAMVQLADGPLRIRLAAPTGKAAARLTESLGGALRQLPLSEAQRASLPADA
GTLHRLLGAQPGSQRFRYHEGNPLHLDVLVVDEASMVDLPMMARLIAALPAHARVIFLGD
RDQLASVEAGAVLGDICAWAAEGYTAGRAAELGRITGYTLEPGPGEQGAALRDCLCLLRK
SYRFGSDSGIGRLASAVNQSDTAGVRQVLAAGYTDICHQVLQESDDYNQMIRQAVAGYGD
YLNGLTTGAEPGAVLEAFGQFRLLCALREGPFGVSGLNERLEQALFRRQLLSAPTGGGRW
YHGRPVMISRNDSALGLFNGDIGITLATEQGLRVWFRMPDGAIKSVLPGRLPAHETAWAM
TVHKSQGSEFDHAALVLPDRLVPVVSRELVYTAITRAKRQLSLYSDTRLLVRAIQTGTER
RSGLAEWFRAAEPGG
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgagcatccgggcactgttacaggacgcggtcgcctgccgctggttacgggccctggac
gcccagttcgccatgatgattgccggggagcagcagcccgcgctgatgctggccgccgcc
ctggtgagccgcgatgcgggggaagggcatgtctgtgtaccgctggcgcgcctggccccg
gaccatatcgacgccggggcccagcgcccgctggtggaggcacttttccaggccgccggg
cagccggaagactggcagcaacagctgctggattcgcccgccgtgagccagggggaggag
gccaccccgctaaaactgcacgccgggcggctctatcttaaccggatgtggcagtacgag
cgccgggtggcgcagtttttcgccgaacaaaaccaggcgctggcggtggatccgcaggcg
ctggccggggtgctggataagctgtttgcccctcagcccgacaccgactggcagaaagtg
gccgccgccgtggccctgacccggcgcattgcggtgatttccggcgggccgggaaccggc
aaaaccaccacggtggcaaaactgttagccgcgatggttcagctggcggacgggccgctg
cggatccgcctggccgccccgaccggtaaagccgccgcccggttaaccgaatcgctgggc
ggtgcgctgcgccagctgccgctcagtgaagcccagcgtgccagcctgcctgcggatgcg
ggtactttgcatcgcctgctgggggcccagccgggcagccagcgttttcgctaccacgag
ggtaacccgctgcatctggatgtgctggtggtggacgaagcctcgatggtggatctcccc
atgatggcgcggctgattgccgcattaccggcacatgcccgggtgattttcctcggcgac
agggatcagctggcgtcggtggaggccggggcggtgctgggggatatctgcgcctgggcg
gcagagggctacaccgccgggcgggccgcagagctcgggagaatcaccgggtataccctg
gagccgggcccgggtgagcagggggcggcgctgcgcgactgcctgtgcctgctgcgcaaa
agttaccgttttggcagtgactccggcatcgggcggcttgccagcgccgttaaccagagc
gacaccgccggggtgcgccaggtgctggccgccgggtatacggatatctgccaccaggta
ctgcaggagagtgacgactataaccagatgatccggcaggcggtggcgggctacggggat
taccttaacgggcttaccacaggggcggagcccggtgcggtgctggaggcgtttggtcag
tttcgcctgctgtgcgccctgcgcgaagggccatttggcgtcagcggcctgaatgagcgc
ctggagcaggcgctgtttcgccgccagttgctgagcgcccccaccggtggcgggcgctgg
tatcacggccgcccggtgatgattagccgtaatgacagcgcactggggctgtttaatggc
gatatcggtatcaccctggccacagagcaggggctgcgggtctggttccggatgccggac
ggggcgattaagtcggtactgccgggccgcttaccggcccatgaaacggcctgggcgatg
acggtgcataaatctcaggggtcggagtttgatcacgcagccctggtgctgccggaccgg
ctggtgccggtggtcagccgcgagctggtctacacggcgataacccgggcgaagcggcag
ttgtcgttgtacagcgatacccgcctgctggtgcgggcgattcagaccggcaccgagcgg
cgcagcgggctggctgagtggttcagggccgcagagcccggagggtaa

DBGET integrated database retrieval system