KEGG   Shimwellia blattae: EBL_c11260Help
Entry
EBL_c11260        CDS       T02111                                 

Gene name
glk
Definition
(RefSeq) glucokinase
  KO
K00845  
glucokinase [EC:2.7.1.2]
Organism
ebt  Shimwellia blattae
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ebt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EBL_c11260 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EBL_c11260 (glk)
   00052 Galactose metabolism
    EBL_c11260 (glk)
   00500 Starch and sucrose metabolism
    EBL_c11260 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    EBL_c11260 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    EBL_c11260 (glk)
   00524 Butirosin and neomycin biosynthesis
    EBL_c11260 (glk)
Enzymes [BR:ebt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     EBL_c11260 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1153660..1154625
Genome map
AA seq 321 aa AA seqDB search
MTKYALVGDVGGTNTRLALCCLESGAISHIQTYSGLEYPSLEAAIQNYIAGQQVSISDGC
IAIACPVTGDRVAMTNHNWAFSIAEMKRNLGFAHLEVINDFTAVSMAIPMLKPEDVIQFG
GQAPQANKPIAVYGAGTGLGVSHLVHVEKRWVTLPGEGGHVDFAPNSEEEAQILEVLRSE
LGHVSAERVLSGPGLVNLYRAIVKADGRLPDNLQPKDITNRALDDSDTDCRRALSLFCVL
MGRFGGNLALNLGTFGGVYIAGGIVPRFMSFFKASGFRGAFEDKGRFKAYVQDIPVFLIT
HPQPGLLGAGAWLRQTLGQVL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagtatgctttggtgggcgatgttggcggaacaaatacgcgcctggcgctgtgt
tgtctggaaagcggggcgatttcccacattcagacttactcggggctggagtacccaagc
ctggaagcggcgatacaaaactatattgccgggcaacaggtgagcatcagcgacggctgc
atcgccattgcctgccccgtaaccggtgaccgggtggcgatgaccaatcacaactgggca
ttttcgattgccgaaatgaaacgtaacctcggttttgcgcatctggaagtgattaacgat
ttcaccgccgtgtcgatggcgatcccgatgctgaaaccggaggatgttatccagttcggc
ggccaggcgccccaggcgaataaacccattgcggtatacggcgccggtacgggccttggg
gtatcacatctggtgcatgtggagaaacgctgggtaaccctgcccggtgaagggggccat
gtggatttcgcccccaacagcgaagaagaggcgcaaatccttgaggtgctgcgcagcgag
ctggggcacgtttctgccgagcgggtgctctctggcccggggctggtgaacctctaccgg
gcgatagtcaaagccgatggccgcctgccggacaatctgcaacccaaagacattacgaac
cgggcgctggatgacagcgacaccgactgtcggcgtgcgctgtcgctgttttgtgtgctg
atggggcgctttggcggcaacctggccctgaatctcggcacctttggcggcgtctatatt
gccggtgggattgtgccgcgctttatgtctttctttaaggcttccgggttccggggggcc
tttgaggataagggccgttttaaagcctatgtacaggatattccggtgttcttgattacc
cacccgcagccgggcctgctgggcgccggtgcctggctgcgccagaccctgggccaggtg
ctctga

DBGET integrated database retrieval system