KEGG   Shimwellia blattae: EBL_c12140Help
Entry
EBL_c12140        CDS       T02111                                 

Gene name
fadJ
Definition
(GenBank) fatty oxidation complex
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ebt  Shimwellia blattae
Pathway
ebt00071  Fatty acid degradation
ebt00280  Valine, leucine and isoleucine degradation
ebt00281  Geraniol degradation
ebt00310  Lysine degradation
ebt00362  Benzoate degradation
ebt00380  Tryptophan metabolism
ebt00410  beta-Alanine metabolism
ebt00640  Propanoate metabolism
ebt00650  Butanoate metabolism
ebt00903  Limonene and pinene degradation
ebt00930  Caprolactam degradation
ebt01040  Biosynthesis of unsaturated fatty acids
ebt01100  Metabolic pathways
ebt01110  Biosynthesis of secondary metabolites
ebt01120  Microbial metabolism in diverse environments
ebt01130  Biosynthesis of antibiotics
ebt01200  Carbon metabolism
ebt01212  Fatty acid metabolism
Module
ebt_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ebt00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    EBL_c12140 (fadJ)
   00650 Butanoate metabolism
    EBL_c12140 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    EBL_c12140 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    EBL_c12140 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EBL_c12140 (fadJ)
   00310 Lysine degradation
    EBL_c12140 (fadJ)
   00380 Tryptophan metabolism
    EBL_c12140 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EBL_c12140 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    EBL_c12140 (fadJ)
   00281 Geraniol degradation
    EBL_c12140 (fadJ)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EBL_c12140 (fadJ)
   00930 Caprolactam degradation
    EBL_c12140 (fadJ)
Enzymes [BR:ebt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     EBL_c12140 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     EBL_c12140 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     EBL_c12140 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AFJ46317
UniProt: I2B713
Position
1253465..1255624
Genome map
AA seq 719 aa AA seqDB search
MEKVCAYTLALREDRIAVITIDVPGEKMNTLQVSRSREVQDILTTLRATRDLAGVIFISA
KPDNFIAGADINMIAGCRTAQQAESLAREGQQLMAEIAGLPVPVVAAIHGACLGGGLELA
LACHRRVCTSDDKTLLGLPEVKLGLLPGSGGTQRLPRLVGASRALEIILSGMMLRPRQAL
KLGLVDEVVPQAILLEAALAQVKSARKPRAPLPLRERLLAAPLVRQLLFRAVTRKTHQQT
HGHYPATERIIDAVRTGLEQGGDSGYQAEARAFGELVMTRESAALRSIFFASNDLKKDPA
SPATARDVQQVGILGGGLMGGGIAYVTAVKGNIPVRIKDISPEGINNALRYSWALLSKKV
QRRQLTAARRGSQMALISGSLDYQGFADREVIIEAVFEDLALKQKMVAEVEAMTRCGAIF
ASNTSSLPIHHIAARAQHPERVIGLHYFSPVDKMPLVEVIPHATTSAETISTTVKLAKRQ
GKTPIVVRDCAGFYVNRILAPYINEGLQCLAEGEPIEHIDRALVAFGFPVGPIQLLDEVG
IDVGTKIIPILEQAYGERFCAPAGVEAILNDDRKGRKNRRGFYLYPAGKQKGGKKADPAI
YRLLHVDPREDQSAELIARRCTLMMLNEAARCLDESVVGSVRDGDIGAVFGIGFPPFLGG
PFRYMDTTGIASIVAQLEQLRARYGERFAPCALLLEMAAHNRSFCQRETRGPHEVVRVA
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagtttgcgcatacaccctggccctgcgtgaggacaggattgcggttatcacg
attgatgtccccggggagaagatgaacacgctgcaggtttcccgcagccgggaagtgcag
gatatcctcaccaccctgcgggcaacacgcgatctggccggggtgatttttatttctgcc
aagccggataactttatcgccggtgccgatatcaacatgatagccggctgccggacggcg
cagcaggcggaaagcctggcccgggaggggcaacagctgatggcggaaatcgccgggctg
ccggtgcccgtggtggccgccattcacggggcctgcctgggcggagggctggagctggca
ctggcctgccatcgccgggtctgcaccagtgatgacaagaccctgctcggcctgccggag
gtcaaactggggctgctgcccggctccgggggtacccagcgcctgccgcgcctggtgggg
gccagccgggcgctggagattatcctctccggcatgatgctgcgcccccgccaggccctg
aaactggggctggtggatgaggtcgtaccgcaggccattttgctggaggccgcactggcc
caggtcaaaagcgcccgcaaaccccgcgccccgttacccctgcgcgagcgtctgctggcc
gcaccgctggtcaggcagctgctgtttcgcgccgttacccgcaaaacgcaccagcagacc
cacggccattacccggccacggaacgcattattgatgcggtaagaacagggctggagcag
gggggcgacagcggataccaggcagaggcccgcgcctttggcgagctggtcatgacccgg
gaatctgcggcattacgcagcatcttctttgccagtaacgatctgaaaaaagatccggca
agcccggccactgcccgtgatgttcagcaggtggggatcctcggcggtggcctgatgggc
ggcggaatagcctatgtcaccgcggttaaaggcaacattccggtacgcattaaagacatc
tccccggaggggatcaacaacgccctgcgctacagctgggcgctgctgagcaaaaaagtg
cagcgccgccagctcacggcggcccggcgcggcagtcagatggcgctgatttccggcagc
ctggattatcaggggtttgccgaccgggaggtgattatcgaagcggtgtttgaagatctg
gcgctgaagcaaaaaatggtggccgaagtggaagccatgacccgctgcggggcaattttt
gcatccaatacctcttcactgcccattcaccacattgctgcccgggcacagcacccggag
cgggtcattggcctgcattacttcagcccggtggataaaatgccgctggtggaggttatc
ccccacgcaaccaccagcgcggaaacgatttccaccacggtaaaactggcgaagcgccag
gggaaaacccctatcgtagtcagagactgcgccgggttctacgttaaccggatcctggcc
ccctatattaacgaggggctgcagtgcctggctgagggcgagcccattgagcatatcgac
agggcgctggtggcgtttggcttcccggtggggcccatccagctgctggatgaagtgggg
attgatgtgggcaccaaaattatccccattcttgaacaggcatacggggagcgcttctgt
gcgcctgcgggggtcgaggccattctcaatgacgaccgtaaagggcgcaaaaaccggcgc
gggttctatctctacccggcgggcaaacaaaaaggcggcaaaaaagccgatccggccatt
taccgcctgctgcatgtggatccccgcgaagatcagtccgcagagctgattgcccggcgc
tgtactttgatgatgctcaacgaggcggcccgctgtctggatgagtcggtggtgggcagc
gtgcgcgacggggatattggcgcggtatttggtatcggttttccgcctttcctcgggggg
ccgttccgttatatggataccaccgggatcgccagtatcgtggcccagcttgagcaatta
cgcgcccgctacggggagcgttttgcgccctgtgcgctgctgctggagatggccgcgcat
aatcgctctttctgccaacgggagacgcgtggtccacatgaagttgtcagggtagcgtga

DBGET integrated database retrieval system