KEGG   Shimwellia blattae: EBL_c16070Help
Entry
EBL_c16070        CDS       T02111                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ebt  Shimwellia blattae
Pathway
ebt00260  Glycine, serine and threonine metabolism
ebt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ebt01100  Metabolic pathways
ebt01110  Biosynthesis of secondary metabolites
ebt01130  Biosynthesis of antibiotics
ebt01230  Biosynthesis of amino acids
Module
ebt_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ebt00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EBL_c16070 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EBL_c16070 (trpA)
Enzymes [BR:ebt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     EBL_c16070 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth
Motif
Other DBs
NCBI-ProteinID: AFJ46701
UniProt: I2B847
Position
complement(1669850..1670662)
Genome map
AA seq 270 aa AA seqDB search
MERYENLFARLKSRGEGAFVPFVTLGDPCAEQSLAIIDALVAGGADALELGIPFSDPLAD
GPTIQNATLRAFASGITPTRCFEMLATIRAKYPTLPIGLLMYANLVFNRGIDEFYAQCAR
AGVDSVLIADVPVEESAPFRQAAMHHNVAPIFICPPNADDELLRQIADYGRGYTYLLSRA
GVTGSENRASLPLHHLVEKLAACHAAPPLQGFGISEPDQVRDAIAAGAAGAISGSAVVKI
IEKHLEQPDVMLCELTAFAHKMKAATVNAQ
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggaacgttatgaaaacttatttgcgcgcctgaaaagccgtggcgaaggcgcatttgtt
cccttcgtcacccttggcgacccttgtgctgagcagtcactggcgattattgatgcgctg
gtggcaggcggagcggatgccctggagctggggatcccgttttctgatccgctggcagat
ggcccgaccattcagaacgccaccctgcgtgcgtttgccagcggcatcacgccgacccgc
tgtttcgagatgctggcgaccatccgcgccaaatacccgacactgcccatcggcctgctg
atgtatgccaacctggtgtttaaccgggggatcgatgagttttacgcccagtgcgcccgg
gccggggtggattcggtgctgattgccgacgtgccggtggaagagtctgccccgttccgc
caggccgccatgcaccataacgtggcgcctatttttatctgcccgcccaacgcggatgac
gaactgctgcgccagattgccgactatggccggggatatacctatctactctcccgtgcc
ggggtcaccggtagcgagaaccgcgccagcctgccgctgcaccatctggtggaaaagctg
gccgcctgccacgccgccccgccgctccagggctttggcatctcggagcccgaccaggtg
cgtgacgctatcgccgccggggctgccggggccatttccggctcggcagtggtgaagatt
atcgaaaaacaccttgagcagccggatgtgatgctgtgcgagctgacggccttcgcccat
aaaatgaaagcggcgaccgtaaacgcacaataa

DBGET integrated database retrieval system