KEGG   Shimwellia blattae: EBL_c16070Help
Entry
EBL_c16070        CDS       T02111                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ebt  Shimwellia blattae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ebt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    EBL_c16070 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EBL_c16070 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EBL_c16070 (trpA)
Enzymes [BR:ebt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     EBL_c16070 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1669850..1670662)
Genome map
AA seq 270 aa AA seqDB search
MERYENLFARLKSRGEGAFVPFVTLGDPCAEQSLAIIDALVAGGADALELGIPFSDPLAD
GPTIQNATLRAFASGITPTRCFEMLATIRAKYPTLPIGLLMYANLVFNRGIDEFYAQCAR
AGVDSVLIADVPVEESAPFRQAAMHHNVAPIFICPPNADDELLRQIADYGRGYTYLLSRA
GVTGSENRASLPLHHLVEKLAACHAAPPLQGFGISEPDQVRDAIAAGAAGAISGSAVVKI
IEKHLEQPDVMLCELTAFAHKMKAATVNAQ
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggaacgttatgaaaacttatttgcgcgcctgaaaagccgtggcgaaggcgcatttgtt
cccttcgtcacccttggcgacccttgtgctgagcagtcactggcgattattgatgcgctg
gtggcaggcggagcggatgccctggagctggggatcccgttttctgatccgctggcagat
ggcccgaccattcagaacgccaccctgcgtgcgtttgccagcggcatcacgccgacccgc
tgtttcgagatgctggcgaccatccgcgccaaatacccgacactgcccatcggcctgctg
atgtatgccaacctggtgtttaaccgggggatcgatgagttttacgcccagtgcgcccgg
gccggggtggattcggtgctgattgccgacgtgccggtggaagagtctgccccgttccgc
caggccgccatgcaccataacgtggcgcctatttttatctgcccgcccaacgcggatgac
gaactgctgcgccagattgccgactatggccggggatatacctatctactctcccgtgcc
ggggtcaccggtagcgagaaccgcgccagcctgccgctgcaccatctggtggaaaagctg
gccgcctgccacgccgccccgccgctccagggctttggcatctcggagcccgaccaggtg
cgtgacgctatcgccgccggggctgccggggccatttccggctcggcagtggtgaagatt
atcgaaaaacaccttgagcagccggatgtgatgctgtgcgagctgacggccttcgcccat
aaaatgaaagcggcgaccgtaaacgcacaataa

DBGET integrated database retrieval system