KEGG   Escherichia blattae DSM 4481: EBL_c16080Help
Entry
EBL_c16080        CDS       T02111                                 

Gene name
trpB
Definition
tryptophan synthase
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ebt  Escherichia blattae DSM 4481
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ebt01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:ebt00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:ebt00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1670662..1671861)
Genome map
AA seq 399 aa AA seqDB search
MRMTTLLNPYFGEFGGMYVPQLLMPALRQLEEAFVSAQSDPAFQQEFHDLLKNYAGRPTA
LTKCRNITAGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVA
SAIACALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWS
GSYEKAHYMLGTAAGPHPFPTIVREFQRMIGEETKAQLQEKEGRLPDAVIAAVGGGSNAI
GMFADFIDNPGVKLIGVEPAGHGIETGEHGAPLKHGRVGIYFGMKSPMMQTDEGQIEESY
SISAGLDFPSVGPQHAYLNSTGRADYVSITDNEALDAFQTLCRHEGILPALESSHALAYA
LKMMKQDPEKEQLLVVNLSGRGDKDIFTVYDILQARGEI
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatgacaacgttacttaacccctattttggtgaatttggcgggatgtatgttccc
cagttactgatgccggccctgcgccagctggaagaggcgtttgtcagcgcccagagcgac
ccggcatttcagcaggaatttcacgatctgctgaaaaactacgcgggccgccccacggca
ctgaccaaatgccgcaatatcaccgccggaacccgcaccaccctctacttaaagcgcgaa
gatttactgcacggcggcgcccataaaacaaaccaggtgctcggccaggcgctgctggca
aaacggatgggcaaaaccgaaattatcgccgagaccggtgccggtcagcacggggtggcc
tcggccattgcctgtgccctgctggggctgaagtgccgcatctatatgggggccaaagat
gtggagcgccagtcacctaacgtgttccgtatgcgcctgatgggggcggaggttatcccg
gttcacagcggctctgccaccctgaaagacgcctgtaacgaggcgctgcgcgactggtcc
ggcagctatgaaaaagcccactatatgctgggcacggcggcgggcccgcacccgttcccg
accattgtgcgcgagttccagcgcatgattggtgaagagaccaaagcccagctgcaggaa
aaagaaggccgcctgccggatgcggtgatcgccgccgtgggcggtggctctaacgccatc
ggcatgtttgcggactttatcgacaacccgggcgtgaagctgataggcgtggagccggcg
ggccacgggatcgaaaccggggagcacggcgcaccgctcaagcacggccgcgtggggatc
tacttcggtatgaaatccccgatgatgcagaccgatgaaggccagattgaagagtcttac
tctatttctgccggtcttgacttcccgtctgtagggccgcagcacgcctaccttaacagc
accggccgggccgattatgtctccatcaccgataacgaagccctggacgcgttccagacc
ctgtgccgccatgaagggatcctgcctgcgctggagtcctcccacgccctggcctatgcc
ctgaaaatgatgaaacaggacccggaaaaagagcagctgctggtggtcaacctctctggc
cgtggtgataaagacatttttactgtgtatgacattctgcaagcccggggagaaatctga

DBGET integrated database retrieval system