KEGG   Shimwellia blattae: EBL_c16610Help
Entry
EBL_c16610        CDS       T02111                                 

Gene name
paaF
Definition
enoyl-CoA hydratase-isomerase
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ebt  Shimwellia blattae
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ebt00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    EBL_c16610 (paaF)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    EBL_c16610 (paaF)
   00650 Butanoate metabolism
    EBL_c16610 (paaF)
  Lipid metabolism
   00071 Fatty acid degradation
    EBL_c16610 (paaF)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EBL_c16610 (paaF)
   00310 Lysine degradation
    EBL_c16610 (paaF)
   00360 Phenylalanine metabolism
    EBL_c16610 (paaF)
   00380 Tryptophan metabolism
    EBL_c16610 (paaF)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EBL_c16610 (paaF)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    EBL_c16610 (paaF)
   00281 Geraniol degradation
    EBL_c16610 (paaF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EBL_c16610 (paaF)
   00627 Aminobenzoate degradation
    EBL_c16610 (paaF)
   00930 Caprolactam degradation
    EBL_c16610 (paaF)
Enzymes [BR:ebt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     EBL_c16610 (paaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1731349..1732116
Genome map
AA seq 255 aa AA seqDB search
MSALISEQQGRVLTLTLNRPEARNALNNSLLTGLADALEAAAGDPGVGAVVITGQPRFFA
AGADLREMASRGLADTLNDPRPLIWQRLDNFPKPLIAAVNGYALGAGCELVLLCDLVIAG
DNASFGLPEITLGLMPGAGGTQRLIRTVGKALASRMVLSGEAISAARAQEAGLVAEVHPA
ALTLEYAQRLAAKIAGHAPLALQAAKQSLRQSQESGLALGLKQERTLFTLLAATDDRREG
IAAFLEKRSPNFTGR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcactgatttctgaacaacaaggccgcgtgctgaccctgacgctaaaccgtccc
gaggcccgcaacgccctgaataacagcctgctgaccgggcttgccgatgcgctggaagcc
gccgccggagatccgggggtgggggcggtggttatcaccgggcagccgcgcttttttgct
gccggtgccgatctgcgcgaaatggccagccgggggctggccgacaccttaaacgatccg
cgcccgctcatctggcagcggctggataatttccctaaaccgctgattgcggcggtcaat
ggctatgccctgggggccggttgcgagctggtattgctgtgcgatctggtgatcgccggg
gataacgccagcttcgggctgccggagataaccctcgggctgatgccgggggccgggggc
acccagcggctgattcgcaccgtgggcaaagcccttgccagccggatggtgctgagcggg
gaggccatctccgccgcccgggcacaggaagcgggtctggtggcggaggtacaccccgcc
gccctgaccctggaatacgcgcagcggctggccgcgaagatagccggtcacgcgcccctg
gcgctgcaggcggccaaacagtccctgcgccagagccaggaaagtggtctggccctgggg
ctgaagcaggagcgcactctgtttaccctgctggccgccactgacgatcgccgggaaggg
atcgccgcttttctggaaaaacgctcgccgaattttacaggacgctaa

DBGET integrated database retrieval system