KEGG   Shimwellia blattae: EBL_c18520Help
Entry
EBL_c18520        CDS       T02111                                 

Definition
di-heme cytochrome c peroxidase family protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
ebt  Shimwellia blattae
Brite
Enzymes [BR:ebt01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     EBL_c18520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1919361..1920749
Genome map
AA seq 462 aa AA seqDB search
MKTRTRLLGAAVLCVAGGYLGLVGYVHYHDTRRNLAYAEQINATAQNARILAMFQDKGCD
YCHTPAAELPFYATLPGVKQLMDYDIQLGYKSFNLSDVRKKLTDNTAVSQSDLNKIEWVM
QHQTMPPTRYTALHWAGGMDEQERALVLAWIKAQREAHYVTPDIAPERRNEPVQPIPLSL
PVDGKKVALGKRLYHDTRLSGDNSISCAHCHQLGAGGADRRKTSLGVGGAIGPINAPTVF
NAVFNVEQFWDGRAPTLQAQAGGPPLNPIEMASKSWDEITGKLRKDASLTRDFTAVYPQG
FSGDTITDAIAEFEKTLITPNGPFDNYLRGDDNALTARQLRGYGLFKEHKCATCHGGVLL
GGDAFEPLGLKKDFMFGDITDADIGRMNVTRDVRDRLRQKVPTLRNVALTEPYFHRGDVA
TLDEAVKLMLHHQVGTSLPQQDVDDIVAFLHSLTGVYTPHPD
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaagaaccaggctattgggtgccgccgtgctgtgcgtggctggcggctatttg
ggtttagtgggttatgtgcactaccacgacacccgacgcaacctcgcttacgccgaacag
atcaacgccacggcacaaaatgccagaatactcgccatgtttcaggataagggctgtgat
tactgccacactcccgccgctgaactgccgttttacgctacgctgcccggtgtaaagcag
ctgatggattatgatatccagctcggatataagtcttttaatctcagcgatgtacgaaaa
aaactcaccgataacaccgccgtttcgcaaagcgatctcaataaaattgaatgggtaatg
cagcaccagaccatgccgcccacgcgctacacggccctgcactgggccggggggatggac
gaacaggagcgtgccctggtactggcatggattaaagcccagcgcgaggcccactatgtg
accccggatatagcaccagagcggcgcaacgagccggtccagccgatcccgctgtcgtta
ccggtcgacgggaagaaagtcgcccttggtaagcgcctgtatcacgatacgcgcctgtcc
ggggataactccatctcctgtgctcactgtcaccagctgggggcagggggtgcagaccgg
cgcaagacctcgctcggggtgggcggcgccattggcccgattaacgcccccacggtattt
aatgcggtatttaatgttgagcagttctgggacgggcgggcacccacccttcaggcccag
gctggggggccacctcttaaccctattgagatggcctcaaaatcctgggatgagatcacc
ggtaagctgcgtaaagacgccagcctgacccgcgactttaccgccgtttacccgcagggc
ttctccggcgacaccatcacagatgccattgcggagtttgagaagacgctgatcaccccc
aatgggccctttgataactacctgcgcggcgatgataacgcgctgactgcccggcagcta
cgcggctatgggctgtttaaagagcataagtgcgccacctgccacggcggggtgctgctc
ggcggggatgcgtttgagccgctggggctgaaaaaggactttatgtttggcgacattact
gatgcggacatcggccggatgaacgtgacccgggatgtgcgcgatcgcctgcgccagaaa
gtgccgacgctgcgcaacgtggcgctgacggagccttacttccaccgtggtgatgtggcc
acccttgatgaggccgtgaagctgatgctgcaccaccaggtgggcacctcgctgccacag
caggatgtggacgatattgtcgccttcctgcactcgcttaccggggtctatacccctcac
ccggattaa

DBGET integrated database retrieval system