KEGG   Shimwellia blattae: EBL_c18950Help
Entry
EBL_c18950        CDS       T02111                                 

Gene name
galU
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ebt  Shimwellia blattae
Pathway
ebt00040  Pentose and glucuronate interconversions
ebt00052  Galactose metabolism
ebt00500  Starch and sucrose metabolism
ebt00520  Amino sugar and nucleotide sugar metabolism
ebt01100  Metabolic pathways
ebt01130  Biosynthesis of antibiotics
Module
ebt_M00362  Nucleotide sugar biosynthesis, prokaryotes
ebt_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ebt00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EBL_c18950 (galU)
   00052 Galactose metabolism
    EBL_c18950 (galU)
   00500 Starch and sucrose metabolism
    EBL_c18950 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    EBL_c18950 (galU)
Enzymes [BR:ebt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     EBL_c18950 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3 DUF4833
Motif
Other DBs
NCBI-ProteinID: AFJ46987
UniProt: I2B8Y3
Position
1967102..1968010
Genome map
AA seq 302 aa AA seqDB search
MAVTKAKVTKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLV
THSSKNSIENHFDTSFELEAMLEKRVKRQLLAEVQAICPPGVTIMQVRQGLAKGLGHAVL
CAHPVVGDEPVAVVLPDVILDEYESDLSKDNLAEMIRRFETDGHSQIMVEPVEDVTAYGV
VDCKGATLNPGDSAPMVGIVEKPKASEAPSNLSVVGRYVLSADIWPLLSKTPPGAGDEIQ
LTDAIAMLMERDPVDAYHLKGKSHDCGNKMGYMQAFVEYGVRHNTLGTEFKAWLKETVGT
KK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaaagctaaagtaacaaaagctgtgattccggtcgcagggctcggaacg
cgtatgttgccggcaacgaaagcaatccctaaagagatgttgccgctggttgataaacca
ctgattcagtacgttgttaacgaatgtattgccgccggtatcactgaaattgttctggtt
acacactcctcgaaaaattccatcgaaaaccacttcgacaccagttttgaactggaagcc
atgctggaaaaacgcgtaaaacgtcagctgctggcagaggtgcaggcaatttgcccgccg
ggcgtcaccatcatgcaggtacgtcagggtctggcgaaaggcctgggccatgcggtgctg
tgtgcgcatccggtagtgggcgatgagccggtggccgtggtgctgccagacgttatcctg
gacgaatacgaatctgatctgagcaaagataaccttgctgaaatgatccgccgctttgaa
accgacggtcacagccagatcatggttgagccggtagaagacgtgaccgcgtacggtgtt
gttgactgcaagggcgccacgctgaacccgggcgacagtgcaccgatggtggggattgtt
gagaaacctaaagccagcgaagcgccgtctaacctctccgttgttggtcgctatgtttta
agcgccgatatctggccgctgctgtctaaaacccctccgggtgccggtgatgagatccag
ctgacagacgccatcgccatgctgatggagcgcgatccggttgatgcgtatcacctgaaa
ggaaaaagccacgattgtggtaacaaaatgggttatatgcaggcattcgttgaatatggc
gtacgccataataccctgggaacagaatttaaggcctggctgaaagagacggtcggcact
aagaaataa

DBGET integrated database retrieval system