KEGG   Shimwellia blattae: EBL_c18990Help
Entry
EBL_c18990        CDS       T02111                                 

Gene name
adhE
Definition
aldehyde-alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
ebt  Shimwellia blattae
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ebt00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    EBL_c18990 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EBL_c18990 (adhE)
   00620 Pyruvate metabolism
    EBL_c18990 (adhE)
   00650 Butanoate metabolism
    EBL_c18990 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    EBL_c18990 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    EBL_c18990 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    EBL_c18990 (adhE)
   00626 Naphthalene degradation
    EBL_c18990 (adhE)
Enzymes [BR:ebt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     EBL_c18990 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     EBL_c18990 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1971573..1974245)
Genome map
AA seq 890 aa AA seqDB search
MAVTNVAELNALVARVKKAQREYANFTQEQVDKIFRAAALAAADARIPLAKMAVEESGMG
IVEDKVIKNHFASEYIYNAYKDEKTCGILEEDKTFGTITIAEPTGIICGIVPTTNPTSTA
IFKSLISLKTRNAIIFSPHPRAKNATNKAADIVLQAAIAAGAPKDIIGWIDEPSVELSNA
LMHHPDLNLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVIDETADIKRAVASILMSKTF
DNGVICASEQSVVVVDSVYDAVRERFATHGGYMLQGKELKAVQDIILKNGGLNAAIVGQP
AVKIAEMAGLTVPASTKILIGEVSVVDESEPFAHEKLSPTLAMYRAKDFEDAVNKAEKLV
AMGGIGHTSCLYTDQDNQQERVNYFGQMMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPVALDEVITDGCK
RALIVTDRFLFNNGYADQITSVLKEAGVEVDVFFEVEADPTLTIVRKGAELCHSFKPDAI
IALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIYKFPKMGVKAKMIAITTTSG
TGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMDMPKSLCAFGGLDAVTHALE
AYVSVLASEFSDGQALEALKLLKENLPASYHEGAKNPVARERVHSAATIAGIAFANAFLG
VCHSMAHKLGSQFHIPHGLANALLICNVIRYNANDNPTKQTAFSQYDRPQARRRYAEIAD
HLRLTAEGDRTAAKIEKLLAWLESMKAELGIPKSIREAGVQEADFLANVDKLAEDAFDDQ
CTGANPRYPLISELKQILLDTYYGHEFTEGEQKKAPQAAPKAEKKSKKSA
NT seq 2673 nt NT seq  +upstreamnt  +downstreamnt
atggctgttactaatgtcgctgaacttaacgcactcgtagcccgtgtgaaaaaagcccag
cgtgaatatgccaactttactcaggaacaggttgataaaatcttccgcgctgccgctctg
gctgccgctgatgcccgcatcccgctggctaagatggcggtagaagagtccggcatgggg
attgtggaagataaggttatcaaaaaccactttgcttccgaatatatctacaacgcctat
aaagacgaaaagacctgcggtattctcgaagaagacaaaaccttcggtactattactatc
gctgagcctaccggcatcatctgcggtatcgttccgaccactaacccgacctccacggct
atctttaaatcgctcatcagcctgaaaacccgtaacgccattatcttctctccgcatccg
cgggcgaaaaatgccaccaataaagcggcagatatcgtactgcaggcggccattgctgcc
ggtgcacctaaagatatcatcggctggatcgatgaaccttccgttgagctgtctaatgcg
ctgatgcatcacccggatctgaacctgattctggcgaccggtggcccgggcatggttaaa
gccgcttacagctccggtaaaccggctatcggcgtgggtgccggtaacacgccagtggtt
atcgacgaaacggcagatatcaagcgggcagttgcctctattctgatgtctaaaaccttc
gacaacggcgttatctgtgcctctgaacagtctgttgtggtggttgactccgtatacgac
gcggtgcgcgagcgtttcgcgacccacggcggctatatgctgcagggtaaagagcttaaa
gccgttcaggatatcatcctgaaaaatggcggcctgaatgcggccatcgttggtcagcct
gcggtgaaaattgccgaaatggcgggcctgaccgtaccggccagcaccaagatcctgatt
ggcgaagtttctgtggttgacgagtctgagccgtttgctcacgaaaaactctcccctact
ctggcaatgtaccgcgcgaaagattttgaagatgcggttaataaagcagagaaactggtc
gccatgggcggtatcggccatacctcctgcctgtataccgaccaggataaccagcaagag
cgcgttaactacttcggccagatgatgaaaacggcccgtatcctgattaacacgccagca
tctcagggtggtatcggtgatctgtacaactttaaactcgccccttcgctgacgctgggc
tgtggttcctggggtggtaactccatctctgaaaacgttggtcctaagcacctgatcaac
aagaaaaccgttgctaagcgagctgaaaacatgttgtggcataaacttccgaaatctatc
tacttccgtcgtggctctctgcctgtcgccctggatgaagtgattactgatggttgcaaa
cgtgcactgatcgtgactgaccgcttcctgttcaacaacggctacgctgaccagataacc
tctgtactgaaagaagccggtgtggaagtggatgtcttcttcgaagtagaagcagatccg
accctgaccatcgtgcgtaaaggcgcggaactgtgccactccttcaaaccagacgctatc
atcgcgctgggcggcggctccccgatggatgcggccaaaattatgtgggtgatgtacgag
cacccggaaacccacttcgaagagctggcgctgcgctttatggatatccgtaaacgtatc
tacaagttcccgaaaatgggcgtgaaagcgaaaatgatcgcgattacaaccacctccggg
accggctctgaagtaacgccgtttgcggtagtgaccgacgacgccaccggccagaaatac
ccgctggctgactatgcgctgaccccggatatggcaattgtcgatgccaacctggtgatg
gatatgccgaaatccctgtgcgcctttggcggcctggatgcggtaacccacgctctggaa
gcctacgtatcggtactggccagcgaattctctgatggccaggcgctggaagcactgaaa
ctgctgaaagaaaacctgccggcttcttaccatgaaggcgcgaaaaacccggttgcccgc
gagcgtgtccacagtgcggccaccatcgccggtatcgcgtttgctaacgccttcctgggt
gtgtgccactctatggcccataaactgggctctcagttccacattccgcacggcctggct
aacgccctgctgatttgcaacgttatccgctataacgcgaacgataacccgaccaaacag
accgcgttcagccagtatgaccgtccgcaggcacgccgtcgctatgctgaaatcgccgac
catctgcgtctgaccgctgaaggcgaccgcaccgcagcgaaaatcgaaaaactgctggcc
tggctggaaagtatgaaagcggaactgggcattcctaagtccatccgtgaagccggggta
caggaagctgacttcctggcaaacgtggataagctggctgaagatgcctttgatgaccag
tgtaccggcgctaacccgcgctacccgctgatctctgagctgaaacagatcctgctggat
acctactacggccacgagttcaccgaaggtgagcagaaaaaagccccgcaagcggcccct
aaagctgagaaaaagagtaagaaaagcgcctaa

DBGET integrated database retrieval system