KEGG   Shimwellia blattae: EBL_c20000Help
Entry
EBL_c20000        CDS       T02111                                 

Gene name
mhpF
Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
ebt  Shimwellia blattae
Pathway
ebt00360  Phenylalanine metabolism
ebt00362  Benzoate degradation
ebt00620  Pyruvate metabolism
ebt00621  Dioxin degradation
ebt00622  Xylene degradation
ebt00650  Butanoate metabolism
ebt01100  Metabolic pathways
ebt01120  Microbial metabolism in diverse environments
ebt01220  Degradation of aromatic compounds
Module
ebt_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ebt00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    EBL_c20000 (mhpF)
   00650 Butanoate metabolism
    EBL_c20000 (mhpF)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    EBL_c20000 (mhpF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EBL_c20000 (mhpF)
   00622 Xylene degradation
    EBL_c20000 (mhpF)
   00621 Dioxin degradation
    EBL_c20000 (mhpF)
Enzymes [BR:ebt01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     EBL_c20000 (mhpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA 2-Hacid_dh_C F420_oxidored CoA_binding Shikimate_DH NAD_binding_3 NSP2-B_epitope
Motif
Other DBs
NCBI-ProteinID: AFJ47091
UniProt: I2B987
Position
complement(2076341..2077291)
Genome map
AA seq 316 aa AA seqDB search
MSMKKVAIIGSGNIGTDLMIKILRNAKHLEMSVMVGIDPESDGLARARRMGVATTHEGVD
GLLNMAEFADIDFVFDATSAGAHIRNDKALRAAKPGIRVIDLTPAAIGPYCVPVVNLEKN
LHQGNVNMVTCGGQATIPMVAAVSRVAKVHYAEIIASIASLSAGPGTRANIDEFTETTSQ
AIEAVGGAEKGKAIIILNPAEPPLMMRDTVYVLSEAANQTEIEASIASMAQEVQAYVPGY
RLKQQVQFEVIPEDKPVHLPGTGTFSGLKTSIFLEVEGAAHYLPAYAGNLDIMTSAALAT
AEKMAQSMGRAAGATA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagtatgaaaaaagtcgccattatcggttcaggcaatatcggcaccgatctgatgatc
aagatcctgcgtaacgcaaaacacctcgaaatgtcggtgatggtggggatcgatccggag
tctgacggcctggcccgtgcccggcgtatgggggtagccaccacccacgaaggggtcgat
ggcctgctgaacatggcggaatttgccgatatcgacttcgtgtttgacgccaccagcgcc
ggggcacatatccgcaatgacaaagccctgcgggcggccaaaccggggatccgggtgatc
gacctcaccccggccgctattggcccctactgtgtaccggtggttaaccttgagaagaac
ctgcaccagggcaacgtcaacatggtgacctgcggcgggcaggcgaccatcccgatggtg
gcggcggtctcccgggtggccaaagtgcactacgcggagattatcgcctctattgccagc
ctctctgccgggccgggcacccgggcgaatattgatgaatttaccgaaaccacctctcag
gccattgaggcggtaggcggcgcggaaaaaggcaaagcgatcattatccttaacccggca
gagccgccgctgatgatgcgcgacacagtctatgtgctgagtgaggcagcaaaccagacg
gagattgaagcctccatcgccagcatggcgcaagaggtgcaggcctatgtgccggggtat
cgcctgaagcagcaggtgcagtttgaggtgatcccggaagataaaccggtccacctgccg
ggtacgggcaccttctccgggctgaaaacgtcaatattccttgaggtagaaggggccgcc
cattacctgccggcctacgccggtaacctcgatattatgacctctgcggcgctggccact
gcggagaaaatggcgcaatccatgggccgcgcagcaggagcgacagcatga

DBGET integrated database retrieval system