KEGG   Shimwellia blattae: EBL_c21900Help
Entry
EBL_c21900        CDS       T02111                                 

Definition
phage lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ebt  Shimwellia blattae
Brite
Enzymes [BR:ebt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     EBL_c21900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2255595..2256095)
Genome map
AA seq 166 aa AA seqDB search
MGNLIKKMSAVAAAGGSAVAIATMLITGPTGHDGLEGVRYRPYQDVAGIRTVCYGHTGKD
IIPGKTYSQAECDELLSHDLATVARQIAPYIRVPVPETTRGALYSFVYNVGVGNFKTSTL
LRKINQGDIHGACDQLRRWTYASGRQWQGLITRREIERQVCLWGDK
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacctgattaaaaagatgtcggcggtagccgctgccggtgggagtgctgttgct
attgcgaccatgctgattaccggcccaacgggccatgatggcctggaaggggtacggtat
cggccctatcaggatgtggctggcatccggacagtctgctacgggcacaccggcaaggac
atcatccccggcaaaacatacagccaggcggagtgcgatgagctgctcagtcatgacctc
gccaccgtggcgcgccagatagccccctatatccgcgttccggtgccggaaaccacccgg
ggggcgctttactcgtttgtctataacgttggcgtcgggaacttcaagacctctacgctg
ctacggaaaatcaaccagggcgatatccacggtgcctgtgatcagctgcgtcgctggacc
tatgccagtggcaggcagtggcagggtctgataacccgtagagagatagagcgccaggtc
tgtttatggggtgacaaatga

DBGET integrated database retrieval system