KEGG   Escherichia blattae DSM 4481: EBL_c23220Help
Entry
EBL_c23220        CDS       T02111                                 

Gene name
ruvA
Definition
holliday junction ATP-dependent DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ebt  Escherichia blattae DSM 4481
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ebt03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2377074..2377685)
Genome map
AA seq 203 aa AA seqDB search
MIGRLRGIVIEKQPPLVLLEAGGVGYEIHMPMTCFYELPELGQEATVFTHFVVREDAQLL
FGFSSKQERTLFRELIKVNGVGPKLALAILSGMSAQQFVNAVEREEPASLVKLPGIGKKT
AERLVVEMKDRFKGMHGDLFTPAADLVLTSPASAAADDAEAEAVAALVSLGYKPQEASRM
VSKIARPEADSETLIREALRAAL
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgataggtcgcttaagaggtatcgtcattgagaaacagccccccctggtattgctggag
gcgggcggtgtcggctatgaaatccatatgccaatgacctgtttctatgagctgccggag
ctgggccaggaggccacggtgttcacccactttgtggtgcgtgaagatgcacagctgctg
tttggctttagcagcaagcaggagcgcaccctgttccgtgagcttatcaaagttaacggt
gtcgggccgaagctggcgctggctatcctgtccgggatgtctgcccagcagtttgtgaat
gcggtagagcgcgaagaaccggcatcgttagtcaaattacccggcattggtaaaaagacc
gccgagcggctggtggtggagatgaaagaccgctttaaaggcatgcacggggatctgttt
accccggcggccgatctggtgctgacatctcccgccagtgccgcggccgacgacgcggaa
gccgaagcggttgccgccctggtctccctggggtataaaccgcaggaagccagccggatg
gtcagtaaaattgcccggccagaggctgacagtgaaaccctgatccgcgaagcattacgc
gcggcgttgtga

DBGET integrated database retrieval system