KEGG   Escherichia blattae DSM 4481: EBL_c23510Help
Entry
EBL_c23510        CDS       T02111                                 

Gene name
pncA
Definition
nicotinamidase/pyrazinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
ebt  Escherichia blattae DSM 4481
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:ebt00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2407228..2407875
Genome map
AA seq 215 aa AA seqDB search
MKQTALLLVDLQNDFCAGGALAVPRGDETIPVANRLIAAFTGQNAPVIATRDWHPAGHGS
FASTHQTTPYTRGELDGLPQTWWPDHCIQHSPGAQLHPLLNGSAVTVTIDKGQDPQIDSY
SGFFDNGHRQQTGLSDWLTRHQINHLVVLGLATDYCVKFTVLDALALHYGVDVITDGCRG
VNIAPEDSALAFQEMAAAGATLYTLADWLDTHPAC
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagactgctttactgctggttgatttacagaatgacttttgtgccggaggggcg
ctggccgttccccggggcgatgagactatcccggtcgccaaccggcttattgcggcgttc
accgggcaaaatgccccggtgattgcaacccgcgactggcacccggcgggccacggcagc
tttgccagcacccaccagactacgccatacacccggggcgagctcgacggcctgccccag
acatggtggccggatcactgtattcagcacagccccggcgcgcaactgcacccgctgctg
aacgggtcagcagtcacggtcacgatagataaaggccaggatccgcaaatcgacagctac
agcggcttttttgataacggccaccgccagcagaccgggctcagcgactggctgacccga
caccagataaaccacctggtggtgctcgggctggcaacggactactgcgtgaaatttacc
gtgctcgacgctctggcgctgcactacggggtcgacgtaataaccgacggttgccggggg
gtgaatatcgcccctgaggacagcgcgctggcctttcaggagatggccgccgccggggcg
accctgtatacccttgccgactggctggacacccaccccgcctgctga

DBGET integrated database retrieval system