KEGG   Shimwellia blattae: EBL_c26240Help
Entry
EBL_c26240        CDS       T02111                                 

Gene name
ybhC
Definition
putative lipoprotein YbhC precursor
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
ebt  Shimwellia blattae
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ebt00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EBL_c26240 (ybhC)
   00500 Starch and sucrose metabolism
    EBL_c26240 (ybhC)
Enzymes [BR:ebt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     EBL_c26240 (ybhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2709551..2710822
Genome map
AA seq 423 aa AA seqDB search
MKTLSVSRLALALISGAALSACSSTPPESQPSTQQAPGTQARPVLSAGEAQNYTRERYFS
DRDPQQPAWQPAPVTVAQTADFVVGPAGEAGVTHTTLQAAVDAAIEKRTSRRQYIAIMPG
NYEGTLYIPAASGSVTLYGLGDNPEAVKIVSAINGHSALSDWRHTVNPSGKYMPGKPAWY
MYDSCQRQHSATAGLMCSAVVWSQNNGLQLKNLTIANTLGDASGEGDNPGVALRTDGDKT
QLDRVNILGRQNTLLFTNSDVHNQMRNDGQPRTLVTDSYIEGDVDMVAGRGAAVFDNTEF
RLVNSRTQKEGYVFAPATLPGIYYGFLAINSRFVASGEGVAQLGRAWDLGAGASGYQPGQ
TANGQVAIRDSVINAGFNREKPWGDASVSLRPFSGNVAEQRNLNDPQYNRMWEYQNHGAG
SQE
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaacattgtccgtttcccgtcttgcgctggcgctgatctcaggagccgcgctgtca
gcctgcagttccacgccgccggagagccagccctctacgcagcaggcgccaggcacccag
gcccggccggttctttctgccggggaggcgcaaaactacacccgggagcgctatttcagc
gaccgggatccccaacagcccgcctggcaaccggccccggttaccgtggcacagacagcg
gattttgtcgtcggccccgccggtgaggccggtgtcacccacaccactctccaggccgct
gttgatgccgctattgagaagcgcaccagccgccgccagtacattgccattatgcccggc
aactatgagggaaccctgtatattccggcggcctccggcagcgtgaccctgtacggcctg
ggggataacccggaagcggtgaagatagtcagcgccatcaatggccacagcgcgctcagt
gactggcgccatacggttaacccgtcgggcaaatatatgccggggaaacccgcgtggtat
atgtatgacagctgccagcgccagcacagcgccaccgcagggctgatgtgctcggcggtg
gtctggtcccagaataacggcctgcaactgaagaacctgaccatagccaacaccctgggc
gacgccagcggcgagggggataaccccggggtcgccttacggacagatggcgacaaaacc
cagcttgaccgggtaaatattctgggccgccagaacaccctgctgtttaccaatagcgat
gttcataaccagatgcgcaatgacggccagccgcgcaccctggtcacggacagctatata
gaaggcgatgtggatatggtggccgggcgcggcgcggcggtgtttgacaatacagaattt
cgcctggtgaacagccgcacgcagaaagaaggctatgtgttcgcccccgccaccctgccc
gggatctactacggtttcctggcaataaacagccgctttgttgccagcggtgagggtgtc
gcccagctgggccgcgcctgggatctgggggccggggccagtggttatcagcccgggcaa
accgccaatggccaggtggctatccgcgacagcgtgattaacgccgggtttaaccgcgaa
aaaccctggggggatgcctccgtcagtctgcgtccgttcagcggcaatgtggctgaacaa
cgtaacctgaacgatccgcagtacaaccggatgtgggagtatcagaaccacggcgccggc
agccaggagtag

DBGET integrated database retrieval system