KEGG   Shimwellia blattae: EBL_c26430Help
Entry
EBL_c26430        CDS       T02111                                 

Gene name
gpmA
Definition
(RefSeq) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ebt  Shimwellia blattae
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ebt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EBL_c26430 (gpmA)
   01230 Biosynthesis of amino acids
    EBL_c26430 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EBL_c26430 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    EBL_c26430 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EBL_c26430 (gpmA)
Enzymes [BR:ebt01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     EBL_c26430 (gpmA)
Exosome [BR:ebt04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   EBL_c26430 (gpmA)
  Exosomal proteins of melanoma cells
   EBL_c26430 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2725365..2726117
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWYDVDLSEKGVGEAKAAGKLLKAEGYAFDFAYTSVL
KRAIHTLWNILDELDQDWLPVEKSWKLNERHYGALQGLNKAETAAKYGDDQVKQWRRGFA
ITPPALTKDDERYPGHDPRYAGLSEKELPLTESLALTIERVVPYWEETILPRLKSGERVI
IAAHGNSLRALVKYLDNMGEKEIIDLNIPTGVPLVYEFDENFKPVKHYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgttactaagctggttctggttcgtcacggtgaaagccagtggaacaatgaaaac
cgcttcaccggttggtacgatgtggacctgtctgagaaaggtgttggcgaagcaaaagcc
gcaggtaaactgctgaaagctgaaggctacgctttcgattttgcctacacttccgtgctg
aaacgagccatccatacgctgtggaatatcctggatgagctggatcaggactggctacct
gttgagaaatcctggaagctgaacgagcgccactacggggcactgcaggggctgaataaa
gcagaaaccgccgccaaatacggcgacgaccaggtgaagcaatggcgccgtggttttgcc
attaccccaccggcactgaccaaagacgacgagcgctacccgggccacgacccgcgctat
gccgggctgagcgagaaagagctgccgttaaccgaaagcctggcgctgactatcgagcgc
gtggtgccctactgggaagagacaatcctgccgcgcctgaaaagcggtgagcgcgtgatc
atcgccgcccacggcaactccctgcgcgcgctggtgaagtatctcgataacatgggcgaa
aaagaaattatcgacctcaacatcccgaccggtgtaccgctggtttatgagttcgacgaa
aacttcaagccggtgaaacactactatctgggcaatgcggacgagatcgccgcaaaagcc
gccgcagttgccaaccagggcaaagcgaaataa

DBGET integrated database retrieval system