KEGG   Shimwellia blattae: EBL_c26660Help
Entry
EBL_c26660        CDS       T02111                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase beta chain with ATP-grasp domain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ebt  Shimwellia blattae
Pathway
ebt00020  Citrate cycle (TCA cycle)
ebt00640  Propanoate metabolism
ebt00660  C5-Branched dibasic acid metabolism
ebt01100  Metabolic pathways
ebt01110  Biosynthesis of secondary metabolites
ebt01120  Microbial metabolism in diverse environments
ebt01130  Biosynthesis of antibiotics
ebt01200  Carbon metabolism
Module
ebt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ebt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ebt00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EBL_c26660 (sucC)
   00640 Propanoate metabolism
    EBL_c26660 (sucC)
   00660 C5-Branched dibasic acid metabolism
    EBL_c26660 (sucC)
Enzymes [BR:ebt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     EBL_c26660 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: AFJ47745
UniProt: I2BB41
Position
complement(2741610..2742776)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFARYGLPAPVGYACTTPREAEEAASKIGAGPWVVKCQVHAGGRGKAGGV
KVVSKKEDIRAFAEAWLGKRLVTYQTDANGQPVNQVLVESATDIAKELYLGAVVDRASRR
VVFMASTEGGVEIEKVAEETPHLIHKVALDPLTGPMPYQGRELAFKLGLEGKQVQQFAKI
FMGLATMFLERDLALVEINPLVITGQGDLICLDGKLTIDSNALFRQPELREMNDASQDDP
REAHAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGAPANFLDVGGGATKERVTE
AFKIILSDENVKAVLVNIFGGIVRCDLIADGIIGAVAEVGVSVPVVVRLEGNNAELGASK
LAESGLNIIAAKSLTDAALQVVAAVEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacatgaatatcaggctaaacaactgtttgcccggtatggtctgccggcaccg
gtgggttatgcctgtactactccccgcgaagctgaagaagcggcatctaaaattggcgcc
ggcccgtgggtggtgaaatgccaggttcatgctggtggtcgtggtaaagcgggcggcgtt
aaagttgtcagcaagaaagaagatatccgtgcttttgccgaagcctggctgggtaaacgc
ctggtgacctaccagacagacgccaatggccagccggtaaaccaggtgctggttgaaagc
gcaacagatattgccaaagagctgtatctgggggcggttgttgaccgtgcttcccgtcgc
gtggtgtttatggcgtccaccgagggtggggtagagattgaaaaagtggcggaagagacg
ccgcacctgatccacaaagtggcactggatccgctgaccggtccgatgccgtaccagggc
cgtgagctggcgttcaaactgggcctggaaggcaagcaggtacagcagttcgcgaagatc
tttatgggccttgcgaccatgttcctggagcgtgacctggcgctggttgagatcaacccg
ctggttattaccggccagggcgatcttatctgcctggacggtaaactgactatcgacagc
aacgctctgttccgccagccggaactgcgcgaaatgaacgatgccagccaggacgatccg
cgcgaagcgcacgctgcccagtgggagctgaactacgtggcgcttgacggtaacatcggc
tgcatggtgaacggcgcaggccttgccatgggcacgatggatatcgtgaaactgcacggc
ggtgctccggctaacttcctggatgttggcggcggcgcaaccaaagagcgcgtaacagaa
gcctttaaaattatcctctccgatgaaaacgttaaagccgttctggtgaacatcttcggc
ggtatcgtacgttgcgatctgattgctgacggtatcatcggcgccgttgccgaagtgggc
gttagcgtaccggtggtggtgcgtctggaaggtaacaacgccgagctgggcgccagcaaa
ctggcagaaagcggcctgaatattattgcagcgaaaagtctgacggatgcagctttgcaa
gttgtagccgctgtggagggtaaataa

DBGET integrated database retrieval system