KEGG   Escherichia blattae DSM 4481: EBL_c26920Help
Entry
EBL_c26920        CDS       T02111                                 

Definition
chitobiase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
ebt  Escherichia blattae DSM 4481
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ebt00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:ebt00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2770070..2772721)
Genome map
AA seq 883 aa AA seqDB search
MFKLSISAAAIAGLLASGAAFAGQQTVDQISQLAVNYTINDNHAGANGVDCAALGADWAS
CNKATITLTNHGAAITDKDWAIYFPSIRQILKIDNDQFAVTHIVGDLHKLTPTDKFTGFP
AGKSVEIPIVNEYWQLFMTDVIPRWYVTSGEATPKVIASTNSEDLSRFVSPLGGDQWKRT
PEDKNILMTAEARFEKNSDVKLLNARNLRGQILPSPSRVTVHGEDVDLSHGVKLDLSALT
APSARAISDRFALLGVKTDGSYPVKTAIAAREFKGDDAVPGAYRLQIGPKEARITGYDEA
GVFYGLQSVLSLIPTQGAMKIATLDAEDAPRFQYRGMFIDVGRNFHSKASILRALDQMAA
YKLNKFHFHLTDDEGWRIEIPGLPELTEVGSKRCHDLSEKTCLLPQLGSGPDTSTNGSGY
FSKADYIEILKYAKARHIEVIPEIDVPAHARAAVISMEARYDRLMKEGKAQEAAAYRLLD
PTDTSNTTGVQFYDRTGYLNPCLESSRHFIDKVIGEIQQMHKEAGLALTTWHFGGDEAKN
IYLGPGYTDKNKPEAGKGQLDLSKQDKPWAKSQVCQTMLKEGKVADLEHLPSWFAVEVSK
IVNKHGIEKMQAWQDGLKDAKDASAFATKRVGVNFWDTLYWGGADSVNDWANKGYEVTIS
NPDYVYLDFPYEVDPQEPGYYWGTRFTDERKLFSFAPNNLPQNAETSVDRDGMTFAAKSD
KPWPGAHGISAQLWSEVVRTDDELEYRLFPRLIAMAERAWHQAGWEQPFQAGKEYQGGVT
HHVDTKALHQDWERFANLLGQRELAKVDKTTLAYRLPVPGAQVAAGVLAANVSLPGLGIE
YSVDGGKQWQRYQDNARPQVSGEVMVRTVSPDGKRTSRATTVR
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaactgagcatatccgcagcggcgattgcgggattacttgccagcggtgcggcg
tttgccgggcagcaaacggtcgaccagataagccagctggcggtgaactacaccattaac
gataaccacgctggcgcaaatggcgtggactgtgccgccctgggggccgactgggcatcc
tgcaataaggcgacaattacgctgaccaaccacggtgcggccatcaccgataaagactgg
gcgatttacttcccgagcattcgccagatcctcaaaatcgacaacgatcagtttgccgtt
acccatattgtgggtgatctgcacaagctgacgccaacggataaattcaccggcttcccg
gccgggaagtcggtagagatcccgatagtcaacgaatactggcagctgtttatgaccgat
gtgatcccgcgctggtatgtgacctccggcgaggcaaccccgaaggtgattgccagcacc
aatagcgaagatctgagccgttttgtctcgccgctgggaggagatcagtggaagcgcacg
ccggaagataaaaacattctgatgacggcagaagcgcgttttgagaaaaacagcgatgta
aaactgctcaatgcccggaacctgcgcggccagatcctgccaagcccctcccgggtaacg
gtacacggcgaggatgtggatctcagccacggggttaagctggatctctctgcgctgacg
gccccgtctgcccgggcgattagcgatcgctttgcgctgctgggggtcaaaacggacggt
agctacccggtaaaaaccgcgattgctgcccgcgaatttaaaggcgatgacgcagtaccc
ggtgcttaccgtttacagattggccccaaagaggcgcggataaccggctatgacgaagcc
ggggtcttttatggtctgcagtctgtgctgtcgctgatcccgacacaaggggcgatgaag
atagccaccctggatgcggaagatgcgccgcgcttccagtaccgggggatgtttattgat
gtggggcgcaacttccacagcaaggcgtctatcctgcgtgcgctggatcagatggcggcc
tacaagctgaataaattccacttccacctgaccgatgatgaaggctggcgcattgaaatc
cccgggctgccggagctgacagaagtcggcagtaagcgctgccacgatctgagtgagaaa
acctgcctgttgccacagctgggttccgggccggatacctcgaccaacggcagcggctat
ttcagtaaagcggactatatcgagatcctcaaatacgcgaaggcgcgccatattgaggtg
atcccggagatagacgtaccggcccacgcccgtgcggcggttatctccatggaagcccgt
tatgatcgtctgatgaaagagggcaaagcgcaggaggccgcggcctaccggctgctggat
ccgaccgatacctcaaacaccacgggcgtgcagttttacgatcgcaccggctacctgaac
ccgtgcctggaatcctcgcgccactttattgataaagtgatcggcgagatccagcagatg
cacaaagaggccgggctggcgctgacgacctggcatttcggtggcgacgaggcgaaaaat
atctacctcggcccggggtatacggataagaacaaaccggaagcgggtaaaggccagctg
gatctcagcaaacaggacaagccctgggcgaagtctcaggtgtgccagaccatgctgaaa
gagggcaaagtggccgatctggagcacctgccgagctggttcgccgtggaggtgagcaag
attgttaataagcacggtatcgagaagatgcaggcctggcaggacggcctcaaagatgcc
aaagatgccagcgccttcgccacgaaacgcgttggggtgaacttctgggataccctgtac
tggggcggggcggattcggtcaatgactgggcgaacaaaggctatgaggtgaccatctct
aacccggattatgtctatctcgacttcccttatgaagtggatccgcaagagccgggatat
tactggggaacacgctttaccgatgagcgcaagctgttcagctttgcccccaataacctg
ccgcaaaatgcggagacctccgtcgatcgcgacggtatgaccttcgcggcgaagtcagac
aaaccctggccgggcgctcacgggatctccgcccagctctggagcgaggtggtgcgcaca
gacgatgagctggaatatcgcctgttcccgcgcctgattgccatggcggagcgtgcctgg
caccaggccgggtgggagcaacctttccaggccggtaaagagtatcaggggggcgtcacg
caccatgtggataccaaagcgctgcaccaggactgggagcgttttgcaaacctgctgggg
cagcgtgagctggcgaaggtggataaaaccacgcttgcataccgcctgccggtgccaggg
gcgcaggtggcagccggggtgctggcggcgaatgtcagcctgccggggcttggtattgaa
tactcggtagatggcggaaagcagtggcagcgctatcaggataatgcccgcccgcaggtc
agcggtgaggtgatggtgcgtactgtcagcccggacggtaaacgtaccagccgggcgaca
acggtacgctga

DBGET integrated database retrieval system