KEGG   Shimwellia blattae: EBL_c27020Help
Entry
EBL_c27020        CDS       T02111                                 

Gene name
asnB
Definition
asparagine synthetase B with glutamine amidotransferase type 2 domain
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ebt  Shimwellia blattae
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ebt00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EBL_c27020 (asnB)
Enzymes [BR:ebt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     EBL_c27020 (asnB)
Peptidases [BR:ebt01002]
 Cysteine Peptidases
  Family C44
   EBL_c27020 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2784485..2786155
Genome map
AA seq 556 aa AA seqDB search
MCSIFGVLDIKTDAGELRKKALELSRLMRHRGPDWSGIYASDKAILAHERLSIVDVNAGA
QPLYNTARTHVLAVNGEIYNHQALRAEYADRYQFQTGSDCEVILALYQEKGADFLDDLQG
MFAFILYDAEKDAWLIGRDHVGIIPLYMGYDEFGNFYVASEMKALTPVCRTIKEFPAGSY
LWSQDGEIRSYYQRDWFSYEAVKDNVTDRNTLRQALEESVKSHLMSDVPYGVLLSGGLDS
SIISAITKKFAARRVEDQERSEAWWPQLHSFAVGLKGSPDLKAAQEVANHLGTVHHEIHF
TVQEGLDAIRDVIYHIETYDVTTIRASTPMYLMSRKIKAMGIKMVLSGEGSDEVFGGYLY
FHKAPNARELHEETVRKLQALHMYDCARANKAMSAWGVEARVPFLDKKFLDVAMRINPQD
KMCGSNGKMEKHILRECFESYLPASVAWRQKEQFSDGVGYSWIDSLKEIANQQVTDQQLE
TAHFRFPYNTPTSKEAWLYREIFEELFPVPSAAECVPGGPSVACSSAKAIEWDEAFKTMD
DPSGRAVGVHQSAYHN
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgtgctcgatttttggtgttctggatattaaaactgacgcaggcgaattacgtaaaaag
gcgctggagctctcgcgtctgatgcgccaccgtggcccggactggtccggtatttatgcc
agcgacaaggcgatactcgcccatgaacgcctgtcaattgttgacgtgaacgccggggcc
cagccgctgtacaacaccgcccgtacccatgtactggccgtaaacggtgaaatctacaac
caccaggccctgcgggcggaatacgccgatcgctaccagttccagaccggctctgactgc
gaagtgatcctcgccctctaccaggaaaaaggcgcagacttccttgatgatctgcagggc
atgtttgcctttattctctatgacgccgaaaaagacgcctggctgattggccgtgaccat
gtgggcattattccgctgtatatgggctatgacgagttcggcaacttctatgtggcctca
gaaatgaaagcgctgacaccggtatgccgcaccatcaaagagttcccggcgggcagctac
ctgtggagccaggacggtgagatccgctcttactaccagcgcgactggttcagctatgag
gcggtcaaagacaacgtgaccgaccgcaacaccctgcgccaggcgctggaagagtcagta
aaaagccacctgatgtctgacgttccctacggtgtactgctctccggcgggctggactcg
tcgattatatctgcgataaccaagaaatttgccgcccgccgggtcgaagaccaggagcgc
agtgaagcctggtggccgcagctgcactcctttgctgtggggctgaaaggctccccggat
ctgaaagccgcccaggaagtggctaaccacctgggcaccgtgcaccatgaaattcacttc
accgtgcaggaaggtctggacgcgatccgcgatgtgatttaccacattgaaacctacgat
gtgaccaccatccgcgcctcaaccccgatgtatctgatgtcgcgcaaaatcaaagcgatg
gggatcaaaatggtgctctccggggaggggtccgatgaggtgtttggcggctatctctat
ttccataaagccccgaacgccagagagctgcacgaagagaccgtacgcaaattacaggcg
ctgcatatgtatgactgcgcccgggccaacaaagccatgtccgcctggggggtggaagcc
cgcgtgcccttcctggataaaaaattcctcgacgtggcaatgcgcatcaacccgcaggac
aaaatgtgcggcagcaacggcaaaatggaaaaacatatcctgcgcgaatgttttgaatcc
tacctgccggcaagcgtggcctggcgccagaaagagcagttctctgacggggtaggctac
agctggatagactcactcaaagagatagccaaccagcaggtgaccgatcagcaactggag
acagcgcactttcgcttcccgtacaacaccccgacctcaaaagaggcctggctgtaccgg
gagatttttgaagagctgttcccggtgccaagcgccgcagagtgtgtgccgggcggcccg
tcagtggcctgctcctcggccaaagccatcgagtgggatgaagccttcaaaaccatggac
gatccctccgggcgtgcggtgggcgtgcaccagtctgcctatcataactaa

DBGET integrated database retrieval system