KEGG   Shimwellia blattae: EBL_c31010Help
Entry
EBL_c31010        CDS       T02111                                 

Gene name
thlA
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ebt  Shimwellia blattae
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:ebt00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    EBL_c31010 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    EBL_c31010 (thlA)
   00640 Propanoate metabolism
    EBL_c31010 (thlA)
   00650 Butanoate metabolism
    EBL_c31010 (thlA)
  Lipid metabolism
   00071 Fatty acid degradation
    EBL_c31010 (thlA)
   00072 Synthesis and degradation of ketone bodies
    EBL_c31010 (thlA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EBL_c31010 (thlA)
   00310 Lysine degradation
    EBL_c31010 (thlA)
   00380 Tryptophan metabolism
    EBL_c31010 (thlA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EBL_c31010 (thlA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EBL_c31010 (thlA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    EBL_c31010 (thlA)
Enzymes [BR:ebt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     EBL_c31010 (thlA)
Exosome [BR:ebt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EBL_c31010 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3187490..3188680
Genome map
AA seq 396 aa AA seqDB search
MTQANDIVVISGVRTAIGTFNGSFKHTHQHDLGAAVIREAVSRAGLAPREVDEVIVGNVG
QIAESGFIARVCQLRAGIPRESTAYSVNRQCGSGLQALANGMIALQSGQADVVVACGTEN
MTQLPYYLRHARNGYRMGNGELEDGLLSILTWPEGPYHNGITAENVAERFGITREAMDDF
AWSSQQKALNAINRGYFREQILPLNVPDGKKATRLFSTDEHPRDTPRDKLATLRPAFKTG
GLVTAANASGINDGAAALVMTTRRHAEKRGLTPRMRIRGWAVAGCSADIMGFGPSPATRR
LMERLDMDVRSVDVIELNEAFAAQALAVINDLHLDPQRVNVNGGAIALGHPVGASGAILP
VKLMYEMARSGARTGLVTLCIGGGQGISMLFEREGA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacacaggcaaatgacattgtggtgataagcggtgtgcgcaccgccattggcacattt
aacggcagctttaaacatacccaccagcacgatctgggtgcggcggtgattcgcgaagcg
gtcagccgtgccgggctggccccccgggaggtggatgaagtgatcgttggcaacgtgggg
cagattgccgaaagcggttttatcgcccgggtctgccagctgcgggccgggatcccccgg
gagagcaccgcctactcggttaaccgccagtgcggctccgggttgcaggccctggcaaac
ggcatgatagcgctgcaaagcggccaggcggatgtggtggttgcctgcggaacggaaaat
atgacgcagctaccctactacctgcgccacgcgcgcaatggctaccgcatgggcaacggc
gagctggaagatggcctgctctcaatactcacctggccggaagggccttatcacaacggt
atcacggcggaaaatgtcgcggagcgcttcggcatcacccgcgaagcgatggacgacttt
gcctggtcaagccagcaaaaagcgctaaatgccatcaacaggggatactttcgcgagcag
atcctcccgcttaacgtgccggacggcaaaaaagcgacccgcctgttcagtaccgatgaa
cacccgcgtgataccccacgcgacaagctcgcgacgctgcgcccggcatttaaaaccggc
ggcctggtaacggcggcgaacgcctccggcattaacgacggcgccgccgcactggtgatg
accacgcgccgccatgccgaaaagcgcggcctgacaccccggatgcgcatccggggctgg
gcggtggcggggtgcagcgcagatattatgggctttggcccctccccggcgacccgccgc
ctgatggagcgcctggacatggatgtgcggtctgtggacgtgattgaacttaacgaagcc
ttcgccgcccaggcgctggcggtgatcaacgatctgcaccttgatccgcagcgggtcaat
gttaacggcggcgcgatcgcgcttggccacccggtgggggccagcggcgcgattttgccg
gtcaaactgatgtatgaaatggcgcgcagcggcgcacgcaccgggctggtcaccctgtgt
attggcggcggccagggcatttccatgttgtttgagcgcgaaggcgcatag

DBGET integrated database retrieval system