KEGG   Shimwellia blattae: EBL_c32200Help
Entry
EBL_c32200        CDS       T02111                                 

Gene name
folK
Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ebt  Shimwellia blattae
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ebt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    EBL_c32200 (folK)
Enzymes [BR:ebt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     EBL_c32200 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3313993..3314493
Genome map
AA seq 166 aa AA seqDB search
MIRCYIALGSNLASPLEQVTGALRALAQIPQSTVVAVSAFYRTPPLGPQDQPDYLNAAVA
LDTTLTPEQLLDNTQRIEQESGRVRKAERWGPRTLDLDIMLFGNQQINTPRLTVPHYDMH
NRMFMLWPLYEIAPDLVFPTGESLKQCLSELSDPPPPRWQDNDCAD
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
gtgatccgctgttatattgcgctgggcagtaatctggcctctccgctggagcaggttacc
ggcgcgctgcgcgcgctggcgcagatcccacaaagcacggtggttgcggtctccgcgttt
taccgcacccctcctctggggccgcaggatcagccggactacctcaacgcggcagtggcg
ctggataccacgctgacgccggagcagttactggataatacccagcgtattgagcaggaa
agtggccgggtgcgtaaagccgaacgctggggaccgcgcacccttgatctggatattatg
ctgtttggcaatcaacagattaataccccgcgcctgaccgtaccgcactacgatatgcac
aaccggatgtttatgctgtggccgctgtatgagattgccccggatctggttttcccgacc
ggtgaaagcctgaaacagtgcctgagtgagctatccgatcctcccccgccccgctggcag
gacaacgattgcgcagactag

DBGET integrated database retrieval system