KEGG   Escherichia blattae DSM 4481: EBL_c33780Help
Entry
EBL_c33780        CDS       T02111                                 

Gene name
holD
Definition
DNA polymerase III
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
ebt  Escherichia blattae DSM 4481
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ebt00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ebt00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:ebt03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:ebt03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ebt03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3493451..3493888)
Genome map
AA seq 145 aa AA seqDB search
MTSRRDWQLQQLGITQWTLRRPAALQGEIAVALSGQTRLVIVASEPPALDDPLVRDVLLS
LALSADQVQCLTPEQLAILPQGSRCNSWRMAIDQPLALAGAQLDTPALDELQQSGAARRA
LWQQICEHEPDFYPQHGLSGRSAGD
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgacttcccgacgcgactggcaactacagcaactggggataacccagtggacgctgcgc
cgccctgcggcgttgcagggggaaattgcggtggccttatccgggcaaacccggctggtg
attgtggccagtgaacccccggcgctggacgatcccctggtacgggatgtcctcttaagc
ctggcgctgagcgccgatcaggtacagtgtctgaccccggaacaactggccatattgccg
caaggcagccgttgcaatagctggcggatggctatcgatcagcccctggccctggcggga
gcacagctggataccccggcgctggatgaacttcaacaaagtggcgcggcgcgcagagcg
ctgtggcagcagatttgtgaacatgaacccgatttctaccctcagcacggactctctggc
cgcagcgctggtgattga

DBGET integrated database retrieval system