KEGG   Shimwellia blattae: EBL_c35050Help
Entry
EBL_c35050        CDS       T02111                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ebt  Shimwellia blattae
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:ebt00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    EBL_c35050 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EBL_c35050 (pyrB)
Enzymes [BR:ebt01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     EBL_c35050 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3627753..3628688
Genome map
AA seq 311 aa AA seqDB search
MANPLYHKHIISINDLSRDELELVLATAASLKANPQPELLKHKVIASCFFEASTRTRLSF
ETSIHRLGASVVGFSDSSNTSLGKKGETLADTISVISTYVDAIVMRHPQEGAARLATEFS
GGIPVVNAGDGANQHPTQTLLDLFTIRETQGRLENLNIAMVGDLKYGRTVHSLTQALAKF
SGNRFYFIAPDALAMPQYILDMLDEKGIAWSLHENMEEVMGELDILYMTRVQKERLDPSE
YANVKAQFILRAADLTGARDNMKVLHPLPRIDEITTDVDTTPHAWYFQQAGNGIFARQAL
LALVLNRDLAL
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggccaacccgctctaccataaacacattatttcaattaacgatctaagccgtgatgaa
ctggaactggtgctggcaacggcggccagcctgaaggcgaaccctcagcccgagctgtta
aaacacaaagtgatcgccagctgcttttttgaggcgtccacccgtacccgcctctctttt
gagacctccatccaccgtcttggcgcgtcggtggtgggcttttccgacagcagcaatacg
tcgctcggcaaaaaaggggaaaccctggccgacaccatttcggttatcagcacctatgtg
gatgcgattgtcatgcgccaccctcaggaaggggccgcccgcctggcaacggagttctcc
ggcgggatcccggtggtaaatgccggtgacggcgcgaaccagcaccccacccagaccctg
ctggatctgttcaccattcgtgaaacccaggggcgcctggaaaacctgaatatcgccatg
gtgggggatctgaagtatggccgcacggtccactccctgacccaggcgctggcgaagttt
agcggtaaccggttctactttatcgccccggatgcgctggctatgccccagtacatcctc
gatatgctggatgagaaaggcatcgcctggagcctgcatgaaaacatggaagaggtgatg
ggcgagctggatattctgtatatgacccgggtacaaaaagagcgccttgacccgtcagag
tatgccaacgtgaaggcgcagtttattctgcgggcggcggatcttaccggcgcccgggac
aatatgaaggtgctgcacccactgccgcgtattgatgaaatcaccaccgacgtagacacc
accccacacgcctggtacttccagcaggcggggaacggtatttttgcccgccaggcactt
ctggcactggttctgaatcgcgatctggcactgtaa

DBGET integrated database retrieval system