KEGG   Escherichia blattae DSM 4481: EBL_c35500Help
Entry
EBL_c35500        CDS       T02111                                 

Gene name
cysQ
Definition
protein CysQ
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ebt  Escherichia blattae DSM 4481
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:ebt00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3674336..3675076)
Genome map
AA seq 246 aa AA seqDB search
MLEQICQLARDAGDAIMQVYQGEQPLDATRKADDSPVTAADIAAHQVILRGLQMLTPDIP
VLSEEAPQPWDERQHWQRYWLVDPLDGTKEFLKHNGEFTVNIALIERGKPVLGVVYAPVK
KVMYSAENGKAWKEECGIRKSIKARDGRPPLVVVSRSHMDDELNDYLAELGDHQTVSVGS
SLKFCLVAEGEAQLYPRFGPTCVWDTAAGHAVAVAAGAQVHDWQGRTLDYTPRESFLNPG
FRVSVF
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgttagaacaaatttgccagctggcccgggacgcgggtgatgcgattatgcaggtctac
cagggggaacaaccgctggatgccacccgcaaagcggatgactcacccgtaacggcggcg
gatattgccgcgcatcaggtgattttacgtggcctgcaaatgctgaccccggacattcct
gtcctgtccgaagaggcgccccagccctgggatgagcgccagcactggcagcgctactgg
ctggttgatccgctggatggcactaaggagttcctcaaacacaacggcgagtttacggtc
aatattgccctgatcgagcggggtaagccggtgctgggggtggtatatgcgccggtcaaa
aaagtgatgtacagcgctgagaacggcaaagcctggaaagaagagtgcggaatacgcaaa
tcgatcaaagcccgggatggccgcccgccgctggtggtggtgagccgctcccatatggat
gatgagcttaacgactatctggccgagcttggcgatcaccagaccgtttcggtgggttca
tcgctgaagttctgcctggtggcggagggggaagcgcaactctacccgcgcttcgggcct
acctgcgtgtgggatacggccgcagggcacgcggttgccgttgcggccggggcgcaggtc
catgactggcagggccggaccctggactataccccccgggagtcgttccttaaccccggg
ttcagagtgtcggttttctag

DBGET integrated database retrieval system