KEGG   Shimwellia blattae: EBL_c36940Help
Entry
EBL_c36940        CDS       T02111                                 

Gene name
aceA
Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
ebt  Shimwellia blattae
Pathway
ebt00630  Glyoxylate and dicarboxylate metabolism
ebt01100  Metabolic pathways
ebt01110  Biosynthesis of secondary metabolites
ebt01120  Microbial metabolism in diverse environments
ebt01200  Carbon metabolism
Module
ebt_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ebt00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    EBL_c36940 (aceA)
Enzymes [BR:ebt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     EBL_c36940 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AFJ48745
UniProt: I2BDZ1
Position
complement(3821901..3823208)
Genome map
AA seq 435 aa AA seqDB search
MTTSRTQQIQQLEQDWKQPRWEGIRRPYSAEEVVKLRGSVNPEYTLARLGAEKMWRLLHG
ESKKGYINSLGALTGGQALQQAKAGIEAIYLSGWQVAADANLAASMYPDQSLYPANSVPA
VVERINNTFQRADQIQWSAGIDRNDPRFTDYFLPIVADAEAGFGGVLNAFELMKAMIQAG
AAAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVLGVPTLLIARTDADAAD
LITSDCDPADHAFITGERTSEGFFRTHAGIEQAISRGLAYAPYADLVWCETSTPDLALAR
RFAQAIHARYPGKLLAYNCSPSFNWKKNLDDKTIASFQLELSDMGYKYQFITLAGIHSMW
FNMFDLAHAYARGEGMRHYVEKVQQPEFARAGDGYTFVSHQQEVGTGYFDKVTTIIQGGS
SSVTALTGSTEESQF
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgacaacatctcgtactcagcaaattcagcaactcgaacaagactggaaacaaccacgc
tgggaggggatccggcgcccctacagtgccgaagaggtggttaaactgcgtggttctgtc
aatccggaatacaccctggcccggctgggggctgagaagatgtggcgcctgctgcatggt
gagtctaaaaaagggtatatcaacagcctcggggcgctcaccggcggccaggcgttacag
caggcgaaagccggtattgaggcgatttacctctccggctggcaggtggcggcagatgcc
aacctggccgccagcatgtacccggatcagtcgctctacccggcaaactccgttccggcg
gtggtggagcggatcaataataccttccagcgggcggatcagatccagtggtctgcgggc
attgatcgcaatgatccgcgctttacggactacttcctgccgatcgtggcagatgctgaa
gccgggttcggcggggtgctgaatgcctttgagctgatgaaggcgatgatccaggccggg
gccgcagcggtgcattttgaagatcagctggcctccgtgaaaaaatgtggccatatgggt
ggcaaggtactggtgccgacccaggaagctatccagaagctggtcgccgcgcgcctggcg
gcggatgtcctcggcgtaccaacgctgctgatagcccggacagacgccgacgcggccgat
ttgatcacctccgattgcgaccccgccgaccacgcctttattaccggggagcgcaccagc
gaaggcttcttccgcacccatgcggggatcgagcaggccatcagccgcgggctggcatat
gccccgtatgcggatctggtgtggtgtgaaacctccaccccggatctggccctggcgcgc
cgctttgcgcaggctatccacgcccgctacccgggtaaactgctggcgtataactgctcc
ccgtcgtttaactggaagaaaaatctggatgataaaaccatcgccagcttccagctggag
ctgtccgacatgggctacaaataccagtttattaccctggcggggatccacagcatgtgg
ttcaacatgtttgatctggcccatgcttacgcccggggcgaggggatgcgccactacgtt
gagaaggtccagcagccggagttcgcccgggcgggcgacggctacacgtttgtgtcgcac
cagcaggaggtgggcaccggctactttgataaagtcaccaccattattcaggggggcagc
tcttcggttaccgcattaaccggctcaacggaagaatcccagttctga

DBGET integrated database retrieval system