KEGG   Shimwellia blattae: EBL_c36950Help
Entry
EBL_c36950        CDS       T02111                                 

Gene name
aceB
Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
ebt  Shimwellia blattae
Pathway
ebt00620  Pyruvate metabolism
ebt00630  Glyoxylate and dicarboxylate metabolism
ebt01100  Metabolic pathways
ebt01110  Biosynthesis of secondary metabolites
ebt01120  Microbial metabolism in diverse environments
ebt01200  Carbon metabolism
Module
ebt_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ebt00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    EBL_c36950 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    EBL_c36950 (aceB)
Enzymes [BR:ebt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     EBL_c36950 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI TPR_16
Motif
Other DBs
NCBI-ProteinID: AFJ48746
UniProt: I2BDZ2
Position
complement(3823313..3824911)
Genome map
AA seq 532 aa AA seqDB search
MTQQATNEEIMFHQPEGELERQVLTPGAVDFIADLVARFTPGRNQLLAARQREQQAIDQG
KLPDFISETASIRNGDWRIRGIPADLQDRRVEITGPVERKMVINALNANVKVFMADFEDS
LAPGWQKVLEGQINLRDAVNGTISYTSETGKIYQLKPDPAVLICRVRGLHLPEKHVSWRD
APIPGSLFDFGLYFYHNYQALLAKGSGPYFYLPKTQSWQEAAWWSEVFSFTEDRFSLPRG
TIKATLLIETLPAVFQMDEILHAMRDHIVGLNCGRWDYIFSYIKTLKNYPDRVLPDRQSV
TMEQPFLSAYSRLLIKTCHKRGAFAMGGMAAFIPSKDEAQNRQVLEKVTADKSLEARNGH
DGTWVAHPGLADTAMAVFNQVLGARKNQLDVRREEDAPISAAQLLEPCPGERTEAGMRAN
IRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIRHNKTLNTGEPVTKALFRT
MLGEEMQVIRREVGDARFAAGRFDDAARLMEQITTSDELIDFLTLPGYRLLA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgacacaacaggctactaacgaagagatcatgtttcaccagccagagggggagctggag
cgccaggtactgacgccaggcgcggtggattttattgccgacctggtggcgcgctttacg
cccgggcgcaatcagttactggcggcccgccagcgggaacagcaggctatcgatcagggg
aaattgccggattttatttcggaaacggcttccatcagaaacggtgactggcgcattcgc
ggcattcccgcggatttacaggatcgtcgggtagagataaccggcccggtagagcgcaaa
atggtgatcaacgcgctcaatgccaatgtaaaagtctttatggccgattttgaagactcc
ctggcccccggctggcaaaaggtgctggaggggcaaatcaacctgcgcgatgcggtgaac
ggcaccatcagctacaccagtgagaccgggaaaatttaccagctgaagccagatccggcg
gtgcttatctgccgggtgcgcggcctgcacctgccggaaaaacacgtaagctggcgggat
gcgccgatccccggcagtttgtttgacttcggactctacttttaccacaactaccaggcc
ctgctggcaaagggcagcgggccctatttttacctgccgaagacccagtcctggcaggag
gcggcctggtggagcgaagtgttcagctttactgaagatcgcttctcgctgccgcgcggc
accattaaagccactttgcttatcgaaacactgcccgccgtgttccagatggacgaaatt
ctgcacgccatgcgtgaccacattgtggggctgaactgcgggcgctgggactatatcttc
agctatatcaaaacactgaaaaattacccggaccgggtactgccggatcgccagagcgtc
accatggagcagcccttcctgagcgcttactcgcgcctgctgatcaaaacctgccataaa
cgcggcgcctttgccatgggcggtatggcggcctttattcccagcaaagacgaggcgcaa
aaccgccaggtgctggagaaggtcaccgccgataaatcccttgaagcccgcaatggtcat
gacggcacctgggtggcgcacccggggctggcagataccgccatggcggtgtttaaccag
gtattaggcgcgcgtaaaaaccagctggatgtccgtcgggaagaagacgcgccgattagc
gccgcacagctgctggagccatgcccgggagagcgtaccgaagcgggcatgcgtgccaat
atccgcgtggcggtgcagtacatcgaagcctggatctccggcaatggctgcgtgcctatc
tacgggctgatggaagacgccgccacggcggaaatctcccgcacgtctatctggcagtgg
atccgccataacaaaacgctcaataccggtgagccggtcacaaaggcgctgtttcgcacc
atgctgggtgaagaaatgcaggttatccgccgggaagtgggcgacgcccgctttgccgcc
gggcgctttgacgatgccgcccggctgatggagcagataaccacctcagatgagcttatc
gacttcctgaccctgccgggttaccggctactggcataa

DBGET integrated database retrieval system