KEGG   Shimwellia blattae: EBL_c36950Help
Entry
EBL_c36950        CDS       T02111                                 

Gene name
aceB
Definition
malate synthase A
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
ebt  Shimwellia blattae
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ebt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EBL_c36950 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    EBL_c36950 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    EBL_c36950 (aceB)
Enzymes [BR:ebt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     EBL_c36950 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3823313..3824911)
Genome map
AA seq 532 aa AA seqDB search
MTQQATNEEIMFHQPEGELERQVLTPGAVDFIADLVARFTPGRNQLLAARQREQQAIDQG
KLPDFISETASIRNGDWRIRGIPADLQDRRVEITGPVERKMVINALNANVKVFMADFEDS
LAPGWQKVLEGQINLRDAVNGTISYTSETGKIYQLKPDPAVLICRVRGLHLPEKHVSWRD
APIPGSLFDFGLYFYHNYQALLAKGSGPYFYLPKTQSWQEAAWWSEVFSFTEDRFSLPRG
TIKATLLIETLPAVFQMDEILHAMRDHIVGLNCGRWDYIFSYIKTLKNYPDRVLPDRQSV
TMEQPFLSAYSRLLIKTCHKRGAFAMGGMAAFIPSKDEAQNRQVLEKVTADKSLEARNGH
DGTWVAHPGLADTAMAVFNQVLGARKNQLDVRREEDAPISAAQLLEPCPGERTEAGMRAN
IRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIRHNKTLNTGEPVTKALFRT
MLGEEMQVIRREVGDARFAAGRFDDAARLMEQITTSDELIDFLTLPGYRLLA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgacacaacaggctactaacgaagagatcatgtttcaccagccagagggggagctggag
cgccaggtactgacgccaggcgcggtggattttattgccgacctggtggcgcgctttacg
cccgggcgcaatcagttactggcggcccgccagcgggaacagcaggctatcgatcagggg
aaattgccggattttatttcggaaacggcttccatcagaaacggtgactggcgcattcgc
ggcattcccgcggatttacaggatcgtcgggtagagataaccggcccggtagagcgcaaa
atggtgatcaacgcgctcaatgccaatgtaaaagtctttatggccgattttgaagactcc
ctggcccccggctggcaaaaggtgctggaggggcaaatcaacctgcgcgatgcggtgaac
ggcaccatcagctacaccagtgagaccgggaaaatttaccagctgaagccagatccggcg
gtgcttatctgccgggtgcgcggcctgcacctgccggaaaaacacgtaagctggcgggat
gcgccgatccccggcagtttgtttgacttcggactctacttttaccacaactaccaggcc
ctgctggcaaagggcagcgggccctatttttacctgccgaagacccagtcctggcaggag
gcggcctggtggagcgaagtgttcagctttactgaagatcgcttctcgctgccgcgcggc
accattaaagccactttgcttatcgaaacactgcccgccgtgttccagatggacgaaatt
ctgcacgccatgcgtgaccacattgtggggctgaactgcgggcgctgggactatatcttc
agctatatcaaaacactgaaaaattacccggaccgggtactgccggatcgccagagcgtc
accatggagcagcccttcctgagcgcttactcgcgcctgctgatcaaaacctgccataaa
cgcggcgcctttgccatgggcggtatggcggcctttattcccagcaaagacgaggcgcaa
aaccgccaggtgctggagaaggtcaccgccgataaatcccttgaagcccgcaatggtcat
gacggcacctgggtggcgcacccggggctggcagataccgccatggcggtgtttaaccag
gtattaggcgcgcgtaaaaaccagctggatgtccgtcgggaagaagacgcgccgattagc
gccgcacagctgctggagccatgcccgggagagcgtaccgaagcgggcatgcgtgccaat
atccgcgtggcggtgcagtacatcgaagcctggatctccggcaatggctgcgtgcctatc
tacgggctgatggaagacgccgccacggcggaaatctcccgcacgtctatctggcagtgg
atccgccataacaaaacgctcaataccggtgagccggtcacaaaggcgctgtttcgcacc
atgctgggtgaagaaatgcaggttatccgccgggaagtgggcgacgcccgctttgccgcc
gggcgctttgacgatgccgcccggctgatggagcagataaccacctcagatgagcttatc
gacttcctgaccctgccgggttaccggctactggcataa

DBGET integrated database retrieval system