KEGG   Escherichia blattae DSM 4481: EBL_c37650Help
Entry
EBL_c37650        CDS       T02111                                 

Gene name
pldB
Definition
lysophospholipase L(2)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
ebt  Escherichia blattae DSM 4481
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:ebt00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3898204..3899193)
Genome map
AA seq 329 aa AA seqDB search
MLKGKNSWFYREKCFAAFTVGPLTAFWQLREEGEFTGVEGVPIRFVKFCAAHHDRVVVIC
PGRIESYVKYAEVAYDLYQHGFDVLIIDHRGQGRSGRLLTDTHRGHVVRFSDYVDDFETF
WMQEVMPGPWRKRYLLAHSMGGAVSVLFLQRHPQAADAVALCAPMFGIIIRFPDWVVRHI
LDWTEERAHLRDNYALGTGRWRALGFSLNVLTHSKERYRRNVRFYADEPAIRVGGPTNHW
VRESLLAAEQVMAGAADITAPLLLIQAAEDHVVENAAHDRFCAAMAEAGHPCDGGQPLVI
PGAYHEILFEKDTMRAAALTAIVDFFKRH
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaggtaaaaatagttggttttacagggaaaaatgcttcgcggcatttaccgtt
ggcccgctgaccgcgttctggcaattacgggaagagggcgaatttacgggtgttgagggg
gtcccgatacgcttcgtgaagttctgcgccgcacaccatgaccgggtggtggtgatttgc
ccggggcgcattgaaagctacgtcaaatacgccgaggtcgcctacgacctgtaccagcac
ggttttgatgtattaattatcgatcaccggggccaggggcgatccggacgcctgctgacg
gatacccatcgcggccacgtggtcagattcagcgactatgtagacgacttcgaaaccttc
tggatgcaggaggtcatgcccggaccgtggcgtaagcgctatctgctggcccactccatg
ggcggggcggtgagcgtgctgttcttacagcgccacccccaggccgccgatgcggtggcc
ctgtgtgcaccgatgttcggcattattattcgcttccccgactgggtagtgcgccatatt
ctggactggaccgaagagcgtgcccacctgcgcgataattacgccctcggcaccggccgc
tggcgggcgctggggtttagcctcaatgtgctgacccacagcaaggagcgctaccggcgt
aatgtgcgcttctatgcggatgaaccggcaatccgggtgggggggccaaccaaccactgg
gtgcgggaaagcctgctcgccgcagagcaggtgatggccggggccgctgatatcaccgca
ccgttattattgatccaggcggctgaggatcacgtggtggaaaacgccgcccacgatcgc
ttctgcgccgccatggcggaggcaggccacccgtgtgacggggggcagccgttagttatc
cccggcgcgtaccatgagatcctgtttgaaaaggacactatgcgcgccgccgcgctgact
gccattgttgattttttcaaacggcattaa

DBGET integrated database retrieval system