KEGG   Escherichia blattae DSM 4481: EBL_c37810Help
Entry
EBL_c37810        CDS       T02111                                 

Gene name
hemD
Definition
uroporphyrinogen III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ebt  Escherichia blattae DSM 4481
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ebt00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3915679..3916425
Genome map
AA seq 248 aa AA seqDB search
MSILVTRPSPAGEQLVARLRSLGREAWHFPLIEFSPGRELAQLPAALAGLRPGDLGFVLS
QHAVEYARRALSHSGQPWPGHVQWFAIGRTTALAFHNVTGLDIRYPQDREISEVLLQLPE
LQNIAGKRALILRGNGGRELLGTTLAARGAEIAYSECYQRSPRHYNGAQEAHRWQQRGIR
TLIVTSGEMLRQLYTLTPEWYRHNWLLTCQLVVVSERLACLARELGWRDIQVADNADNDA
LLRALPSQ
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcctggtcacccgcccctctcctgccggagagcaactggtcgcacgtttgcgc
agcctggggcgggaggcctggcattttccgctgattgaattctcccccgggcgcgagctg
gcacagcttccggcggccctggccgggctgaggccgggcgatctcggatttgtcctgtca
caacatgcggtagagtacgcccggcgcgcgctgagccacagcggccagccctggcccggg
catgttcagtggttcgccattggcagaactaccgcgctggcgtttcacaacgtgaccggg
ctggatattcgctatccgcaggatcgggaaatcagcgaagtcttgctacaattacctgaa
ttgcaaaatattgccgggaagcgggcgctgatcctgcgcggcaatggcggccgcgagctg
ctgggtacgaccctggcggcgcgcggcgcagagatagcctacagcgaatgctaccagcgt
agccccaggcactataacggcgcgcaggaggcccatcgctggcaacagcgcggtattcgc
acgcttatcgtgaccagcggggagatgctgcgccagctgtatacgcttacgccggagtgg
tatcggcacaactggttgctgacctgtcaactggtggtcgtcagtgagcgtctggcatgc
ctggcccgggagctgggctggcgggatattcaggtcgccgacaatgcggacaatgatgcg
ctattacgcgcgttaccatcacagtaa

DBGET integrated database retrieval system