KEGG   Escherichia blattae DSM 4481: EBL_c38670Help
Entry
EBL_c38670        CDS       T02111                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ebt  Escherichia blattae DSM 4481
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ebt00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4006707..4008218
Genome map
AA seq 503 aa AA seqDB search
MTTEKKYIVALDQGTTSSRAVVMDHDANIVSVSQREFEQIYPKAGWVEHDPMEIWASQSS
TLVEALAKADIGSDQIAAIGITNQRETTIVWEKETGKPIYNAIVWQCRRTADICEQLKRD
GMEEYIRHATGLVIDPYFSGTKVKWILDHVEGARERARRGELLFGTVDTWLIWRMTQGRV
HVTDYTNASRTMLFNIHDLQWDDKMLDALDIPREMLPEVRKSSEVYGQTNIGGKGGTRIP
ISGIAGDQQAALFGQLCVKQGMAKNTYGTGCFMLMNTGTQAVRSGHGLLTTIACGPRGEV
NYALEGAVFMGGASIQWLRDEMKLINDAADSEYFAGKVKDSNGVYVVPAFTGLGAPYWDP
YARGAILGLTRGVNANHIIRATLESIAYQTRDVLEAMQADAGIRLHALRVDGGAVANNFL
MQFQADILGTRVERPEVREVTALGAAYLAGLAVGYWQNLDELSEKATIEREFRPGIETVE
RNYRYEGWKKAVKRALAWEDHDQ
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgactaccgaaaagaaatacattgtcgcgctcgaccagggcaccaccagctcccgcgcc
gtggtcatggatcatgatgctaacattgtcagcgtctcacagcgtgaatttgagcaaatc
taccccaaagcaggctgggttgagcacgaccccatggagatctgggcctcccagagctca
acactggtcgaagcactggccaaagcggatattggctctgatcagattgccgccatcggg
atcacgaaccagcgcgaaaccaccatcgtctgggaaaaagagaccggcaaacccatttat
aacgccattgtctggcagtgccgccgcaccgcggatatctgcgagcagctaaaacgcgac
ggcatggaggagtatatccgccacgccacaggcctggtgatcgacccgtatttctccggt
acaaaagtaaaatggatcctcgaccacgtagaaggggcccgtgagcgggccagacgcggc
gagctgttattcggtactgtggatacctggcttatctggcgtatgacccagggccgggta
cacgtcaccgactacaccaacgcctcacgcaccatgctgttcaatatccacgacttacag
tgggacgacaaaatgctggacgccctggacatcccgcgggagatgctgccagaggtgcgt
aaatcctccgaagtttacggccagaccaacattggcggtaaaggcggcacccgtattccc
atctccgggatcgccggggatcagcaggcggccctgttcggccagctgtgtgttaaacag
gggatggcgaaaaacacctacggcaccggctgctttatgctgatgaacaccggcacccag
gcggtacgctccggccacgggcttctgaccaccatcgcctgcggcccacgcggggaagtg
aactacgcccttgaaggggcggtatttatggggggtgcctccatccagtggctgcgcgac
gaaatgaagctgattaacgacgcggccgactcggaatactttgccggtaaagtgaaagac
agcaacggggtgtatgtggttccggcgttcaccggcctgggtgccccgtactgggatccc
tatgcccgtggagccatcctcgggctgacccgtggggtaaacgctaaccatattatccgc
gccacccttgagtctatcgcctaccagacccgcgatgtgctggaagccatgcaggcagat
gcgggtatccgcctccacgccctgcgggtagacggtggcgccgtggccaacaacttcctg
atgcagttccaggccgatatcctcggcacccgggttgagcgcccggaagtgcgggaagtg
accgccctcggggccgcttatctggcgggcctggcggttggctactggcaaaacctcgac
gagctgagcgagaaagccaccattgagcgtgaattccgccccggtatcgagaccgtggag
cgtaattaccgttacgaaggctggaaaaaagccgttaaacgcgcgcttgcctgggaagat
cacgatcagtaa

DBGET integrated database retrieval system