KEGG   Shimwellia blattae: EBL_c38720Help
Entry
EBL_c38720        CDS       T02111                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ebt  Shimwellia blattae
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ebt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EBL_c38720 (tpiA)
   01230 Biosynthesis of amino acids
    EBL_c38720 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EBL_c38720 (tpiA)
   00051 Fructose and mannose metabolism
    EBL_c38720 (tpiA)
   00562 Inositol phosphate metabolism
    EBL_c38720 (tpiA)
Enzymes [BR:ebt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     EBL_c38720 (tpiA)
Exosome [BR:ebt04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   EBL_c38720 (tpiA)
  Exosomal proteins of bladder cancer cells
   EBL_c38720 (tpiA)
  Exosomal proteins of melanoma cells
   EBL_c38720 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4011441..4012208
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSKQMVNELIAGLRKELSTVDGCDVAIAPPLMYVELADRYIGGSHIH
LGAQDVGLHRSGAYTGEISPTMLKDVGAEYIIIGHSERRTYHGETDELIAEKFAVLKEEG
LIPVLCIGETEAENEAGQTEEVVARQIDAVLKTMGAKALEGAVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKADAQVAAGIIIQYGGSVNAANAAELFGQPDIDGALVGGASLKAD
AFAAIVKAAATAKKA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatcctttagtgatgggtaactggaaactcaacggcagcaaacaaatggtcaac
gaactgattgctggcctgcgtaaggaactgtccactgttgatggctgtgacgtagcaatc
gccccgcctctcatgtatgtagaactggccgaccgttatatcggcggcagccatatccac
ctcggtgctcaggacgtgggcctgcaccgctctggcgcttacaccggtgaaatctccccg
accatgctgaaagacgtgggcgctgagtacatcatcatcggccactctgagcgccgtacc
tatcacggtgaaactgacgagctgattgctgaaaaatttgccgtactgaaagaagaaggc
ctgatcccggtactgtgcatcggtgaaaccgaagctgaaaacgaagccggtcagactgaa
gaagtggttgcccgccagatcgacgcggtgctgaaaaccatgggcgcgaaagcactggaa
ggtgccgttatcgcctacgaacctgtatgggctatcggtacgggtaaatccgcaaccccg
gctcaggcacaggcagtacacaaatttatccgcgaccatatcgctaaagccgacgcccag
gtagcagcaggcattatcatccagtacggtggttccgtgaacgctgcgaacgccgcagag
ctgtttggccagccggatatcgacggcgcgctggttggcggtgcatccctgaaagcagac
gctttcgcggccatcgttaaagcggcagccactgcgaaaaaagcgtaa

DBGET integrated database retrieval system