KEGG   Shimwellia blattae: EBL_c38720Help
Entry
EBL_c38720        CDS       T02111                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ebt  Shimwellia blattae
Pathway
ebt00010  Glycolysis / Gluconeogenesis
ebt00051  Fructose and mannose metabolism
ebt00562  Inositol phosphate metabolism
ebt01100  Metabolic pathways
ebt01110  Biosynthesis of secondary metabolites
ebt01120  Microbial metabolism in diverse environments
ebt01130  Biosynthesis of antibiotics
ebt01200  Carbon metabolism
ebt01230  Biosynthesis of amino acids
Module
ebt_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ebt_M00002  Glycolysis, core module involving three-carbon compounds
ebt_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ebt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EBL_c38720 (tpiA)
   00051 Fructose and mannose metabolism
    EBL_c38720 (tpiA)
   00562 Inositol phosphate metabolism
    EBL_c38720 (tpiA)
Enzymes [BR:ebt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     EBL_c38720 (tpiA)
Exosome [BR:ebt04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   EBL_c38720 (tpiA)
  Exosomal proteins of bladder cancer cells
   EBL_c38720 (tpiA)
  Exosomal proteins of melanoma cells
   EBL_c38720 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM DUF3254
Motif
Other DBs
NCBI-ProteinID: AFJ48900
UniProt: I2BEE6
Position
4011441..4012208
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSKQMVNELIAGLRKELSTVDGCDVAIAPPLMYVELADRYIGGSHIH
LGAQDVGLHRSGAYTGEISPTMLKDVGAEYIIIGHSERRTYHGETDELIAEKFAVLKEEG
LIPVLCIGETEAENEAGQTEEVVARQIDAVLKTMGAKALEGAVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKADAQVAAGIIIQYGGSVNAANAAELFGQPDIDGALVGGASLKAD
AFAAIVKAAATAKKA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatcctttagtgatgggtaactggaaactcaacggcagcaaacaaatggtcaac
gaactgattgctggcctgcgtaaggaactgtccactgttgatggctgtgacgtagcaatc
gccccgcctctcatgtatgtagaactggccgaccgttatatcggcggcagccatatccac
ctcggtgctcaggacgtgggcctgcaccgctctggcgcttacaccggtgaaatctccccg
accatgctgaaagacgtgggcgctgagtacatcatcatcggccactctgagcgccgtacc
tatcacggtgaaactgacgagctgattgctgaaaaatttgccgtactgaaagaagaaggc
ctgatcccggtactgtgcatcggtgaaaccgaagctgaaaacgaagccggtcagactgaa
gaagtggttgcccgccagatcgacgcggtgctgaaaaccatgggcgcgaaagcactggaa
ggtgccgttatcgcctacgaacctgtatgggctatcggtacgggtaaatccgcaaccccg
gctcaggcacaggcagtacacaaatttatccgcgaccatatcgctaaagccgacgcccag
gtagcagcaggcattatcatccagtacggtggttccgtgaacgctgcgaacgccgcagag
ctgtttggccagccggatatcgacggcgcgctggttggcggtgcatccctgaaagcagac
gctttcgcggccatcgttaaagcggcagccactgcgaaaaaagcgtaa

DBGET integrated database retrieval system