KEGG   Escherichia blattae DSM 4481: EBL_c38780Help
Entry
EBL_c38780        CDS       T02111                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ebt  Escherichia blattae DSM 4481
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:ebt01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ebt01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ebt00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:ebt00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ebt00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ebt00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:ebt00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4017135..4018097)
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRAALTEGLEVYGIYDGYLGLYEDRMISLDRYSVSD
MINRGGTFLGSARFPEFREESVRAVAIENMKKRGLDALVVIGGDGSYMGAKRLTEMGFPC
IGLPGTIDNDIKGTDYTIGFFTALSTVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLA
AAIAGGCEYIVVPEVEFNREELVEGIKAGIAKGKKHAIVAITEHMCDVHELSTYIEKETG
RETRATVLGHIQRGGSPVPYDRILASRMGAYAIELLLQGYGGRCVGIQNEKLVHHDIIDA
IEHMKRPFKGDWLDCAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaaaatcggtgtattgacgagcggcggtgatgcgccaggcatgaacgcggcg
atccgtggcgtggttcgtgcggcgttaactgaaggtcttgaagtttatggtatctatgac
ggctacctcggcttgtatgaagatcgcatgattagcctggaccgttacagcgtttccgac
atgatcaaccgcggcggcaccttcctgggctctgcgcgtttccctgaattccgtgaagag
agcgtgcgcgccgttgccatcgaaaacatgaaaaaacggggtctggatgcgctggtggtt
atcggtggtgacggttcctacatgggggccaaacgtcttaccgagatgggtttcccgtgc
atcggcctgccgggcactatcgataacgacatcaaaggcactgactacaccatcggcttc
tttacggcgctgagcacggtcgttgaagcgattgaccgtctgcgcgacacctcttcttcc
caccagcgtatttcaattgttgaagtgatgggccgctactgtggcgatctgaccctggct
gcggccattgccggtggctgtgagtatatcgtggtgccggaggttgaatttaaccgcgaa
gagctggttgaaggcatcaaagccggtattgcgaaaggcaaaaaacacgcgattgtcgcc
atcaccgagcacatgtgcgacgtgcatgagctttccacctacattgaaaaagagaccggc
cgcgaaacccgcgccacggttctgggccatattcagcgtggcggctcgccggtgccttac
gatcgtattctggcctcccgtatgggcgcttacgccattgaattactgctgcagggctat
ggtggccgctgcgtcggtattcagaacgaaaaactggttcatcacgatattattgacgcc
attgagcatatgaagcggccgtttaaaggcgactggctggactgcgctaaaaaactgtac
taa

DBGET integrated database retrieval system