KEGG   Shimwellia blattae: EBL_c38780Help
Entry
EBL_c38780        CDS       T02111                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ebt  Shimwellia blattae
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ebt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EBL_c38780 (pfkA)
   01230 Biosynthesis of amino acids
    EBL_c38780 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EBL_c38780 (pfkA)
   00030 Pentose phosphate pathway
    EBL_c38780 (pfkA)
   00051 Fructose and mannose metabolism
    EBL_c38780 (pfkA)
   00052 Galactose metabolism
    EBL_c38780 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    EBL_c38780 (pfkA)
Enzymes [BR:ebt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     EBL_c38780 (pfkA)
Protein phosphatases and associated proteins [BR:ebt01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     EBL_c38780 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4017135..4018097)
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRAALTEGLEVYGIYDGYLGLYEDRMISLDRYSVSD
MINRGGTFLGSARFPEFREESVRAVAIENMKKRGLDALVVIGGDGSYMGAKRLTEMGFPC
IGLPGTIDNDIKGTDYTIGFFTALSTVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLA
AAIAGGCEYIVVPEVEFNREELVEGIKAGIAKGKKHAIVAITEHMCDVHELSTYIEKETG
RETRATVLGHIQRGGSPVPYDRILASRMGAYAIELLLQGYGGRCVGIQNEKLVHHDIIDA
IEHMKRPFKGDWLDCAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaaaatcggtgtattgacgagcggcggtgatgcgccaggcatgaacgcggcg
atccgtggcgtggttcgtgcggcgttaactgaaggtcttgaagtttatggtatctatgac
ggctacctcggcttgtatgaagatcgcatgattagcctggaccgttacagcgtttccgac
atgatcaaccgcggcggcaccttcctgggctctgcgcgtttccctgaattccgtgaagag
agcgtgcgcgccgttgccatcgaaaacatgaaaaaacggggtctggatgcgctggtggtt
atcggtggtgacggttcctacatgggggccaaacgtcttaccgagatgggtttcccgtgc
atcggcctgccgggcactatcgataacgacatcaaaggcactgactacaccatcggcttc
tttacggcgctgagcacggtcgttgaagcgattgaccgtctgcgcgacacctcttcttcc
caccagcgtatttcaattgttgaagtgatgggccgctactgtggcgatctgaccctggct
gcggccattgccggtggctgtgagtatatcgtggtgccggaggttgaatttaaccgcgaa
gagctggttgaaggcatcaaagccggtattgcgaaaggcaaaaaacacgcgattgtcgcc
atcaccgagcacatgtgcgacgtgcatgagctttccacctacattgaaaaagagaccggc
cgcgaaacccgcgccacggttctgggccatattcagcgtggcggctcgccggtgccttac
gatcgtattctggcctcccgtatgggcgcttacgccattgaattactgctgcagggctat
ggtggccgctgcgtcggtattcagaacgaaaaactggttcatcacgatattattgacgcc
attgagcatatgaagcggccgtttaaaggcgactggctggactgcgctaaaaaactgtac
taa

DBGET integrated database retrieval system