KEGG   Escherichia coli K-12 MC4100(MuLac) BW2952: BWG_0080Help
Entry
BWG_0080          CDS       T00913                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
ebw  Escherichia coli K-12 MC4100(MuLac) BW2952
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:ebw00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:ebw00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
93165..94652
Genome map
AA seq 495 aa AA seqDB search
MADRNLRDLLAPWVPDAPSRALREMTLDSRVAAAGDLFVAVVGHQADGRRYIPQAIAQGV
AAIIAEAKDEATDGEIREMHGVPVIYLSQLNERLSALAGRFYHEPSDNLRLVGVTGTNGK
TTTTQLLAQWSQLLGEISAVMGTVGNGLLGKVIPTENTTGSAVDVQHELAGLVDQGATFC
AMEVSSHGLVQHRVAALKFAASVFTNLSRDHLDYHGDMEHYEAAKWLLYSEHHCGQAIIN
ADDEVGRRWLAKLPDAVAVSMEDHINPNCHGRWLKATEVNYHDSGATIRFSSSWGDGEIE
SHLMGAFNVSNLLLALATLLALGYPLADLLKTAARLQPVCGRMEVFTAPGKPTVVVDYAH
TPDALEKALQAARLHCAGKLWCVFGCGGDRDKGKRPLMGAIAEEFADVAVVTDDNPRTEE
PRAIINDILAGMLDAGHAKVMEGRAEAVTCAVMQAKENDVVLVAGKGHEDYQIVGNQRLD
YSDRVTVARLLGVIA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
gtggcagatcgtaatttgcgcgaccttcttgctccgtgggtgccagacgcaccttcgcga
gcactgcgagagatgacactcgacagccgtgtggctgcggcgggcgatctctttgtagct
gtagtaggtcatcaggcggacgggcgtcgatatatcccgcaggcgatagcgcaaggtgtg
gctgccattattgcagaggcgaaagatgaggcgaccgatggtgaaatccgtgaaatgcac
ggcgtaccggtcatctatctcagccagctcaacgagcgtttatctgcactggcgggccgc
ttttaccatgaaccctctgacaatttacgtctcgtgggcgtaacgggcaccaacggcaaa
accacgactacccagctgttggcgcagtggagccaactgcttggcgaaatcagcgcggta
atgggcaccgttggtaacggcctgctggggaaagtgatcccgacagaaaatacaaccggt
tcggcagtcgatgttcagcatgagctggcggggctggtggatcagggcgcgacgttttgc
gcaatggaagtttcctcccacgggctggtacagcaccgtgtggcggcattgaaatttgcg
gcgtcggtctttaccaacttaagccgcgatcaccttgattatcatggtgatatggaacac
tacgaagccgcgaaatggctgctttattctgagcatcattgcggtcaggcgattattaac
gccgacgatgaagtgggccgccgctggctggcaaaactgccggacgcggttgcggtatca
atggaagatcatattaatccgaactgtcacggacgctggttgaaagcgaccgaagtgaac
tatcacgacagcggtgcgacgattcgctttagctcaagttggggcgatggcgaaattgaa
agccatctgatgggcgcttttaacgtcagcaacctgctgctcgcgctggcgacactgttg
gcactcggctatccactggctgatctgctgaaaaccgccgcgcgtctgcaaccggtttgc
ggacgtatggaagtgttcactgcgccaggcaaaccgacggtggtggtggattacgcgcat
acgccggatgcactggaaaaagccttacaggcagcgcgtctgcactgtgcgggcaagctg
tggtgtgtctttggctgtggtggcgatcgcgataaaggtaagcgtccactgatgggcgca
attgccgaagagtttgctgacgtggcggtggtgacggacgataacccgcgtaccgaagaa
ccgcgtgccatcatcaacgatattctggcgggaatgttagatgccggacatgccaaagtg
atggaaggccgtgctgaagcggtgacttgcgccgttatgcaggctaaagagaatgatgtg
gtactggtcgcgggcaaaggccatgaagattaccagattgttggcaatcagcgtctggac
tactccgatcgcgtcacggtggcgcgtctgctgggggtgattgcatga

DBGET integrated database retrieval system