KEGG   Escherichia coli K-12 MC4100(MuLac) BW2952: BWG_0427Help
Entry
BWG_0427          CDS       T00913                                 

Gene name
arrD
Definition
DLP12 prophage; putative lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ebw  Escherichia coli K-12 MC4100(MuLac) BW2952
Brite
Enzymes [BR:ebw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     BWG_0427 (arrD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
479596..480093
Genome map
AA seq 165 aa AA seqDB search
MPPSLRKAVAAAIGGGAIAIASVLITGPSGNDGLEGVSYIPYKDIVGVWTVCHGHTGKDI
MLGKTYTKAECKALLNKDLATVARQINPYIKVDIPETTRGALYSFVYNVGAGNFRTSTLL
RKINQGDIKGACDQLRRWTYAGGKQWKGLMTRREIEREVCLWGQQ
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgcctccatcattacgaaaagccgttgctgctgctattggtggcggagcaattgctata
gcatcagtgttaatcactggcccaagtggtaacgatggtctggaaggtgtcagctacata
ccatacaaagatattgttggtgtatggactgtatgtcacggacacaccggaaaagacatc
atgctcggtaaaacgtataccaaagcagaatgcaaagcactcttgaataaagaccttgcc
actgtcgccagacaaattaacccgtatatcaaagtcgatataccggaaacaacgcgcggc
gctctttactcattcgtttacaacgtgggtgctggcaattttagaacatcgacgcttctt
cgcaaaataaaccagggcgatatcaaaggcgcatgtgatcagctgcgtcgctggacatac
gctggcggtaagcaatggaaaggcctgatgactcgtcgtgagattgagcgtgaagtctgt
ttgtgggggcaacagtga

DBGET integrated database retrieval system