KEGG   Escherichia coli BW2952: BWG_0581Help
Entry
BWG_0581          CDS       T00913                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase, membrane subunit, binds cytochrome b556
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
ebw  Escherichia coli BW2952
Pathway
ebw00020  Citrate cycle (TCA cycle)
ebw00190  Oxidative phosphorylation
ebw00650  Butanoate metabolism
ebw01100  Metabolic pathways
ebw01110  Biosynthesis of secondary metabolites
ebw01120  Microbial metabolism in diverse environments
ebw01130  Biosynthesis of antibiotics
ebw01200  Carbon metabolism
Module
ebw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ebw_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ebw_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ebw00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BWG_0581 (sdhD)
   00650 Butanoate metabolism
    BWG_0581 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    BWG_0581 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ACR65587
Structure
PDB: 

Jmol
Position
657543..657890
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFFASAFTKVF
TLLALFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYVIYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcctccgcattaggacgcaatggcgtacatgatttcatcctcgttcgc
gctaccgctatcgtcctgacgctctacatcatttatatggtcggttttttcgctaccagt
ggcgagctgacatatgaagtctggatcggtttcttcgcctctgcgttcaccaaagtgttc
accctgctggcgctgttttctatcttgatccatgcctggatcggcatgtggcaggtgttg
accgactacgttaaaccgctggctttgcgcctgatgctgcaactggtgattgtcgttgca
ctggtggtttacgtgatttatggattcgttgtggtgtggggtgtgtga

DBGET integrated database retrieval system