KEGG   Escherichia coli K-12 MC4100(MuLac) BW2952: BWG_0585Help
Entry
BWG_0585          CDS       T00913                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ebw  Escherichia coli K-12 MC4100(MuLac) BW2952
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ebw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BWG_0585 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BWG_0585 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    BWG_0585 (sucB)
Enzymes [BR:ebw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BWG_0585 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
663505..664722
Genome map
AA seq 405 aa AA seqDB search
MSSVDILVPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDKVVLEVPASADGILDAV
LEDEGTTVTSRQILGRLREGNSAGKETSAKSEEKASTPAQRQQASLEEQNNDALSPAIRR
LLAEHNLDASAIKGTGVGGRLTREDVEKHLAKAPAKESAPAAAAPAAQPALAARSEKRVP
MTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEAFEKRHGIRLGFMSFYVK
AVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLVTPVLRDVDTLGMADIEKKIK
ELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAVNG
QVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRLLLDV
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatattctggtccctgacctgcctgaatccgtagccgatgccaccgtc
gcaacctggcataaaaaacccggcgacgcagtcgtacgtgatgaagtgctggtagaaatc
gaaactgacaaagtggtactggaagtaccggcatcagcagacggcattctggatgcggtt
ctggaagatgaaggtacaacggtaacgtctcgtcagatccttggtcgcctgcgtgaaggc
aacagcgccggtaaagaaaccagcgccaaatctgaagagaaagcgtccactccggcgcaa
cgccagcaggcgtctctggaagagcaaaacaacgatgcgttaagcccggcgatccgtcgc
ctgctggctgaacacaatctcgacgccagcgccattaaaggcaccggtgtgggtggtcgt
ctgactcgtgaagatgtggaaaaacatctggcgaaagccccggcgaaagagtctgctccg
gcagcggctgctccggcggcgcaaccggctctggctgcacgtagtgaaaaacgtgtcccg
atgactcgcctgcgtaagcgtgtggcagagcgtctgctggaagcgaaaaactccaccgcc
atgctgaccacgttcaacgaagtcaacatgaagccgattatggatctgcgtaagcagtac
ggtgaagcgtttgaaaaacgccacggcatccgtctgggctttatgtccttctacgtgaaa
gcggtggttgaagccctgaaacgttacccggaagtgaacgcttctatcgacggcgatgac
gtggtttaccacaactatttcgacgtcagcatggcggtttctacgccgcgcggcctggtg
acgccggttctgcgtgatgtcgataccctcggcatggcagacatcgagaagaaaatcaaa
gagctggcagtcaaaggccgtgacggcaagctgaccgttgaagatctgaccggtggtaac
ttcaccatcaccaacggtggtgtgttcggttccctgatgtctacgccgatcatcaacccg
ccgcagagcgcaattctgggtatgcacgctatcaaagatcgtccgatggcggtgaatggt
caggttgagatcctgccgatgatgtacctggcgctgtcctacgatcaccgtctgatcgat
ggtcgcgaatccgtgggcttcctggtaacgatcaaagagttgctggaagatccgacgcgt
ctgctgctggacgtgtag

DBGET integrated database retrieval system