KEGG   Escherichia coli BW2952: BWG_0607Help
Entry
BWG_0607          CDS       T00913                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase 1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ebw  Escherichia coli BW2952
Pathway
ebw00010  Glycolysis / Gluconeogenesis
ebw00260  Glycine, serine and threonine metabolism
ebw00680  Methane metabolism
ebw01100  Metabolic pathways
ebw01110  Biosynthesis of secondary metabolites
ebw01120  Microbial metabolism in diverse environments
ebw01130  Biosynthesis of antibiotics
ebw01200  Carbon metabolism
ebw01230  Biosynthesis of amino acids
Module
ebw_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ebw_M00002  Glycolysis, core module involving three-carbon compounds
ebw_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ebw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BWG_0607 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    BWG_0607 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BWG_0607 (gpmA)
Enzymes [BR:ebw01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BWG_0607 (gpmA)
Membrane trafficking [BR:ebw04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BWG_0607 (gpmA)
Exosome [BR:ebw04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BWG_0607 (gpmA)
  Exosomal proteins of melanoma cells
   BWG_0607 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 TAF6_C
Motif
Other DBs
NCBI-ProteinID: ACR64044
UniProt: C4ZXS6
Structure
PDB: 

Jmol
Position
complement(689034..689786)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVI
IAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPLKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggttcgtcatggcgaaagtcagtggaacaaagaaaac
cgtttcaccggttggtacgacgtggatctgtctgagaaaggcgtaagcgaagcaaaagca
gcaggtaagctgctgaaagaggaaggttacagctttgactttgcttacacttctgtgctg
aaacgcgctatccataccctgtggaatgtgctggacgaactggatcaggcatggctgccc
gttgagaaatcctggaaactgaacgaacgtcactacggtgcgttgcagggtctgaacaaa
gcggaaactgctgaaaagtatggcgacgagcaggtgaaacagtggcgtcgtggttttgca
gtgactccgccggaactgactaaagatgatgagcgttatccgggtcacgatccgcgttac
gcgaaactgagcgagaaagaactgccgctgacggaaagcctggcgctgaccattgaccgc
gtgatcccttactggaatgaaactattctgccgcgtatgaagagcggtgagcgcgtgatc
atcgctgcacacggtaactctttacgtgcgctggtgaaatatcttgataacatgagcgaa
gaagagattcttgagcttaatatcccgactggcgtgccgctggtgtatgagttcgacgag
aatttcaaaccgctgaaacgctattatctgggtaatgctgacgagatcgcagcgaaagca
gcggcggttgcaaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system