KEGG   Escherichia coli K-12 MC4100(MuLac) BW2952: BWG_1222Help
Entry
BWG_1222          CDS       T00913                                 

Gene name
paaF
Definition
(RefSeq) enoyl-CoA hydratase-isomerase
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ebw  Escherichia coli K-12 MC4100(MuLac) BW2952
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ebw00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    BWG_1222 (paaF)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BWG_1222 (paaF)
   00650 Butanoate metabolism
    BWG_1222 (paaF)
  Lipid metabolism
   00071 Fatty acid degradation
    BWG_1222 (paaF)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BWG_1222 (paaF)
   00310 Lysine degradation
    BWG_1222 (paaF)
   00360 Phenylalanine metabolism
    BWG_1222 (paaF)
   00380 Tryptophan metabolism
    BWG_1222 (paaF)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BWG_1222 (paaF)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BWG_1222 (paaF)
   00281 Geraniol degradation
    BWG_1222 (paaF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BWG_1222 (paaF)
   00627 Aminobenzoate degradation
    BWG_1222 (paaF)
   00930 Caprolactam degradation
    BWG_1222 (paaF)
Enzymes [BR:ebw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BWG_1222 (paaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Structure
PDB: 

Jmol
Position
1347580..1348347
Genome map
AA seq 255 aa AA seqDB search
MSELIVSRQQRVLLLTLNRPAARNALNNALLMQLVNELEAAATDTSISVCVITGNARFFA
AGADLNEMAEKDLAATLNDTRPQLWARLQAFNKPLIAAVNGYALGAGCELALLCDVVVAG
ENARFGLPEITLGIMPGAGGTQRLIRSVGKSLASKMVLSGESITAQQAQQAGLVSDVFPS
DLTLEYALQLASKMARHSPLALQAAKQALRQSQEVALQAGLAQERQLFTLLAATEDRHEG
ISAFLQKRTPDFKGR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaactgatcgtcagccgtcagcaacgagtattgttgctgacccttaaccgtccc
gccgcacgtaatgcgctaaataatgccctgctgatgcaactggtaaatgaactggaagct
gcggctaccgataccagcatttcggtctgtgtgattaccggtaatgcacgcttttttgcc
gctggggccgatctcaacgaaatggcagaaaaagatctcgcggccaccttaaacgataca
cgtccgcagctatgggcgcgattgcaggcctttaataaaccacttatcgcagccgtcaat
ggttacgcgcttggggcgggttgcgaactggcattgttgtgcgatgtggtggttgccgga
gagaacgcgcgttttgggttgccggaaatcactctcggcatcatgcctggcgcaggcgga
acgcaacgtttaatccgtagtgtcggtaaatcgttagccagcaaaatggtgctgagcgga
gaaagtatcaccgctcagcaagcacagcaggccgggctggttagcgacgtcttccccagc
gatttaaccctcgaatacgccttacagctggcatcgaaaatggcacgtcactcgccgctg
gccttacaagcggcaaagcaagcgctgcgccagtcgcaggaagtggctttgcaagccgga
cttgcccaggagcgacagttattcaccttgctggcggcaacagaagatcgtcatgaaggc
atctccgctttcttacaaaaacgcacgcccgactttaaaggacgctaa

DBGET integrated database retrieval system