KEGG   Escherichia coli K-12 MC4100(MuLac) BW2952: BWG_1222Help
Entry
BWG_1222          CDS       T00913                                 

Gene name
paaF
Definition
enoyl-CoA hydratase-isomerase
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ebw  Escherichia coli K-12 MC4100(MuLac) BW2952
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ebw00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    BWG_1222 (paaF)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BWG_1222 (paaF)
   00650 Butanoate metabolism
    BWG_1222 (paaF)
  Lipid metabolism
   00071 Fatty acid degradation
    BWG_1222 (paaF)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BWG_1222 (paaF)
   00310 Lysine degradation
    BWG_1222 (paaF)
   00360 Phenylalanine metabolism
    BWG_1222 (paaF)
   00380 Tryptophan metabolism
    BWG_1222 (paaF)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BWG_1222 (paaF)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BWG_1222 (paaF)
   00281 Geraniol degradation
    BWG_1222 (paaF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BWG_1222 (paaF)
   00627 Aminobenzoate degradation
    BWG_1222 (paaF)
   00930 Caprolactam degradation
    BWG_1222 (paaF)
Enzymes [BR:ebw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BWG_1222 (paaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1347580..1348347
Genome map
AA seq 255 aa AA seqDB search
MSELIVSRQQRVLLLTLNRPAARNALNNALLMQLVNELEAAATDTSISVCVITGNARFFA
AGADLNEMAEKDLAATLNDTRPQLWARLQAFNKPLIAAVNGYALGAGCELALLCDVVVAG
ENARFGLPEITLGIMPGAGGTQRLIRSVGKSLASKMVLSGESITAQQAQQAGLVSDVFPS
DLTLEYALQLASKMARHSPLALQAAKQALRQSQEVALQAGLAQERQLFTLLAATEDRHEG
ISAFLQKRTPDFKGR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaactgatcgtcagccgtcagcaacgagtattgttgctgacccttaaccgtccc
gccgcacgtaatgcgctaaataatgccctgctgatgcaactggtaaatgaactggaagct
gcggctaccgataccagcatttcggtctgtgtgattaccggtaatgcacgcttttttgcc
gctggggccgatctcaacgaaatggcagaaaaagatctcgcggccaccttaaacgataca
cgtccgcagctatgggcgcgattgcaggcctttaataaaccacttatcgcagccgtcaat
ggttacgcgcttggggcgggttgcgaactggcattgttgtgcgatgtggtggttgccgga
gagaacgcgcgttttgggttgccggaaatcactctcggcatcatgcctggcgcaggcgga
acgcaacgtttaatccgtagtgtcggtaaatcgttagccagcaaaatggtgctgagcgga
gaaagtatcaccgctcagcaagcacagcaggccgggctggttagcgacgtcttccccagc
gatttaaccctcgaatacgccttacagctggcatcgaaaatggcacgtcactcgccgctg
gccttacaagcggcaaagcaagcgctgcgccagtcgcaggaagtggctttgcaagccgga
cttgcccaggagcgacagttattcaccttgctggcggcaacagaagatcgtcatgaaggc
atctccgctttcttacaaaaacgcacgcccgactttaaaggacgctaa

DBGET integrated database retrieval system