KEGG   Escherichia coli K-12 MC4100(MuLac) BW2952: BWG_1828Help
Entry
BWG_1828          CDS       T00913                                 

Gene name
rfbC
Definition
dTDP-4-deoxyrhamnose-3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
ebw  Escherichia coli K-12 MC4100(MuLac) BW2952
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:ebw00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:ebw00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2000088..2000645)
Genome map
AA seq 185 aa AA seqDB search
MNVIRTEIEDVLILEPRVFGDDRGFFYESFNQSAFEHILGYPVSFVQDNHSRSSKNVLRG
LHFQRGEYAQDKLVRCTHGAVFDVAVDIRPNSVSFGKWVGVLLSADNKQQLWIPKGFAHG
FLVLSDIAEFQYKTTNYYHPESDCGICWNDERIAIDWPQTSGLILSPKDERLFTLDELIR
LKLIA
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgattagaactgaaattgaagatgtgctaattctggagccaagagtatttggt
gatgatagaggtttcttttatgagagctttaatcaatcagcatttgaacatattctaggc
tatccggtcagctttgttcaagacaatcactcacgttcatcaaaaaatgtactcagaggc
cttcactttcaacgcggcgagtacgcacaagataaacttgtacgctgcactcatggagca
gtttttgatgttgctgttgatattcgacccaattcggtatcctttggtaaatgggttggt
gttctgctttcagctgataataagcagcagttgtggataccaaaagggtttgctcatggc
tttttggttctgtctgatatcgctgaatttcaatataaaactacaaactattatcatcct
gaaagcgattgtggaatatgttggaatgatgaacgcattgcaattgattggccccaaaca
tcagggttaatcctttcgccaaaagatgaaaggctctttacgttagatgagcttatcaga
ttaaaattaattgcatga

DBGET integrated database retrieval system