KEGG   Escherichia coli K-12 MC4100(MuLac) BW2952: BWG_3220Help
Entry
BWG_3220          CDS       T00913                                 

Gene name
bcsZ
Definition
endo-1,4-D-glucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ebw  Escherichia coli K-12 MC4100(MuLac) BW2952
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ebw00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3575672..3576778)
Genome map
AA seq 368 aa AA seqDB search
MNVLRSGIVTMLLLAAFSVQAACTWPAWEQFKKDYISQEGRVIDPSDARKITTSEGQSYG
MFSALAANDRAAFDNILDWTQNNLAQGSLKERLPAWLWGKKENSKWEVLDSNSASDGDVW
MAWSLLEAGRLWKEQRYTDIGSALLKRIAREEVVTVPGLGSMLLPGKVGFAEDNSWRFNP
SYLPPTLAQYFTRFGAPWTTLRETNQRLLLETAPKGFSPDWVRYEKDKGWQLKAEKTLIS
SYDAIRVYMWVGMMPDSDPQKARMLNRFKPMATFTEKNGYPPEKVDVATGKAQGKGPVGF
SAAMLPFLQNRDAQAVQRQRVADNFPGSDAYYNYVLTLFGQGWDQHRFRFSTKGELLPDW
GQECANSH
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgttgcgtagtggaatcgtgacgatgctgctgctggctgcctttagtgttcag
gcagcctgtacctggcctgcctgggagcagtttaaaaaggattacatcagtcaggaaggg
cgcgtcatcgaccccagcgacgcgcgcaaaatcaccacctccgaagggcaaagttacggc
atgttctctgccctggcggctaacgaccgtgcagctttcgataatattctcgactggacg
cagaacaatctcgctcagggttctttaaaagaacgtttgcccgcctggctgtggggcaag
aaagagaacagtaagtgggaagtgctggacagcaattcggcctccgatggtgatgtctgg
atggcctggtcgttgctggaggcggggcgtttgtggaaagagcagcgttataccgacatc
ggcagcgcgttgctaaaacgtatcgcgcgggaggaagtggtgacggtgcctgggctgggt
tccatgttgttaccgggcaaagtgggttttgctgaggataacagctggcgttttaacccc
agctacctgccgccgacgctggcgcagtatttcacccgctttggcgcgccgtggaccacg
ctgcgcgaaaccaatcaacgtttattgctggaaaccgccccgaaaggtttttcgccagac
tgggtgcgctatgagaaagacaaaggctggcagctaaaagccgaaaaaacattgatcagc
agctacgacgctatccgcgtttacatgtgggtaggcatgatgcctgacagcgatccgcaa
aaagcgcggatgctcaaccggtttaaaccgatggcgacattcactgagaaaaacggttat
ccgccggaaaaagtggatgtggctacggggaaagcgcagggtaaaggaccagtcggtttt
tctgccgccatgctgccctttttacaaaaccgcgatgcgcaggccgttcagcgccagcgc
gtggccgataactttcccggcagcgatgcctattacaactatgtgctgaccctgtttgga
caaggctgggatcaacaccgtttccgcttctcgacaaaaggtgagttattacctgactgg
ggccaggaatgcgcaaattcacactaa

DBGET integrated database retrieval system