KEGG   Escherichia coli K-12 MC4100(MuLac) BW2952: BWG_3633Help
Entry
BWG_3633          CDS       T00913                                 

Gene name
trmA
Definition
tRNA (uracil-5-)-methyltransferase
Orthology
K00557  
tRNA (uracil-5-)-methyltransferase [EC:2.1.1.35]
Organism
ebw  Escherichia coli K-12 MC4100(MuLac) BW2952
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(4049862..4050962)
Genome map
AA seq 366 aa AA seqDB search
MTPEHLPTEQYEAQLAEKVVRLQSMMAPFSDLVPEVFRSPVSHYRMRAEFRIWHDGDDLY
HIIFDQQTKSRIRVDSFPAASELINQLMTAMIAGVRNNPVLRHKLFQIDYLTTLSNQAVV
SLLYHKKLDDEWRQEAEALRDALRAQNLNVHLIGRATKTKIELDQDYIDERLPVAGKEMI
YRQVENSFTQPNAAMNIQMLEWALDVTKGSKGDLLELYCGNGNFSLALARNFDRVLATEI
AKPSVAAAQYNIAANHIDNVQIIRMAAEEFTQAMNGVREFNRLQGIDLKSYQCETIFVDP
PRSGLDSETEKMVQAYPRILYISCNPETLCKNLETLSQTHKVERLALFDQFPYTHHMECG
VLLTAK
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgacccccgaacaccttccaacagaacagtatgaagcgcagttagccgaaaaagtggta
cgtttgcaaagtatgatggcaccgttttctgacctggttccggaagtgtttcgctcgccg
gtcagtcattaccggatgcgcgcggagttccgcatctggcacgatggcgatgacctgtat
cacatcattttcgatcaacaaaccaaaagccgcatccgcgtggatagcttccccgccgcc
agtgaacttatcaaccagttgatgacggcgatgattgcgggtgtgcgtaataatcccgtt
ctgcgccacaagttgttccagattgattacctcactacactgagtaatcaggcggtggtt
tccctgctataccataagaagctggatgatgagtggcgtcaggaagcggaggccctgcgc
gatgcactgcgcgcgcagaatctgaatgtgcatctgattggtcgggcaacgaaaaccaaa
atcgagctggatcaggattacatcgatgaacgtctgccggtcgcagggaaagagatgatc
taccgtcaggtagaaaacagctttacccagccgaacgcggcgatgaatattcagatgctg
gaatgggcgctggacgtaaccaaaggctcaaaaggcgatttactggagctgtactgcggc
aacggtaacttttcattagcgctggcgcgtaattttgatcgggtattagccaccgaaatc
gctaagccgtcggttgctgctgcgcaatacaacatcgcagctaaccatattgataacgta
caaattattcgtatggcggcagaagaatttactcaggcgatgaatggtgtgcgcgagttt
aaccgcctgcaagggatcgacttaaagagttatcagtgcgaaaccatttttgtcgaccct
ccgcgcagcggtctggacagtgaaaccgagaaaatggtgcaggcgtatccgcgtattttg
tacatctcctgtaacccggaaacgttatgcaagaatctggaaacattaagccagacgcac
aaggtcgaacgtctggctctgtttgatcagttcccctacacgcaccatatggagtgcggc
gtattactgaccgcgaagtaa

DBGET integrated database retrieval system