KEGG   Escherichia coli BW2952: BWG_3671Help
Entry
BWG_3671          CDS       T00913                                 

Gene name
aceA
Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
ebw  Escherichia coli BW2952
Pathway
ebw00630  Glyoxylate and dicarboxylate metabolism
ebw01100  Metabolic pathways
ebw01110  Biosynthesis of secondary metabolites
ebw01120  Microbial metabolism in diverse environments
ebw01200  Carbon metabolism
Module
ebw_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ebw00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BWG_3671 (aceA)
Enzymes [BR:ebw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     BWG_3671 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ACR63561
Structure
PDB: 

Jmol
Position
4104812..4106116
Genome map
AA seq 434 aa AA seqDB search
MKTRTQQIEELQKEWTQPRWEGITRPYSAEDVVKLRGSVNPECTLAQLGAAKMWRLLHGE
SKKGYINSLGALTGGQALQQAKAGIEAVYLSGWQVAADANLAASMYPDQSLYPANSVPAV
VERINNTFRRADQIQWSAGIEPGDPRYVDYFLPIVADAEAGFGGVLNAFELMKAMIEAGA
AAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVTGVPTLLVARTDADAADL
ITSDCDPYDSEFITGERTSEGFFRTHAGIEQAISRGLAYAPYADLVWCETSTPDLELARR
FAQAIHAKYPGKLLAYNCSPSFNWQKNLDDKTIASFQQQLSDMGYKFQFITLAGIHSMWF
NMFDLANAYAQGEGMKHYVEKVQQPEFAAAKDGYTFVSHQQEVGTGYFDKVTTIIQGGTS
SVTALTGSTEESQF
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacccgtacacaacaaattgaagaattacagaaagagtggactcaaccgcgttgg
gaaggcattactcgcccatacagtgcggaagatgtggtgaaattacgcggttcagtcaat
cctgaatgcacgctggcgcaactgggcgcagcgaaaatgtggcgtctgctgcacggtgag
tcgaaaaaaggctacatcaacagcctcggcgcactgactggcggtcaggcgctgcaacag
gcgaaagcgggtattgaagcagtctatctgtcgggatggcaggtagcggcggacgctaac
ctggcggccagcatgtatccggatcagtcgctctatccggcaaactcggtgccagctgtg
gtggagcggatcaacaacaccttccgtcgtgccgatcagatccaatggtccgcgggcatt
gagccgggcgatccgcgctatgtcgattacttcctgccgatcgttgccgatgcggaagcc
ggttttggcggtgtcctgaatgcctttgaactgatgaaagcgatgattgaagccggtgca
gcggcagttcacttcgaagatcagctggcgtcagtgaagaaatgcggtcacatgggcggc
aaagttttagtgccaactcaggaagctattcagaaactggtcgcggcgcgtctggcagct
gacgtgacgggcgttccaaccctgctggttgcccgtaccgatgctgatgcggcggatctg
atcacctccgattgcgacccgtatgacagcgaatttattaccggcgagcgtaccagtgaa
ggcttcttccgtactcatgcgggcattgagcaagcgatcagccgtggcctggcgtatgcg
ccatatgctgacctggtctggtgtgaaacctccacgccggatctggaactggcgcgtcgc
tttgcacaagctatccacgcgaaatatccgggcaaactgctggcttataactgctcgccg
tcgttcaactggcagaaaaacctcgacgacaaaactattgccagcttccagcagcagctg
tcggatatgggctacaagttccagttcatcaccctggcaggtatccacagcatgtggttc
aacatgtttgacctggcaaacgcctatgcccagggcgagggtatgaagcactacgttgag
aaagtgcagcagccggaatttgccgccgcgaaagatggctataccttcgtatctcaccag
caggaagtgggtacaggttacttcgataaagtgacgactattattcagggcggcacgtct
tcagtcaccgcgctgaccggctccactgaagaatcgcagttctaa

DBGET integrated database retrieval system