KEGG   Pectobacterium atrosepticum SCRI1043: ECA0014Help
Entry
ECA0014           CDS       T00186                                 

Gene name
rbsK
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
eca  Pectobacterium atrosepticum SCRI1043
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:eca00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ECA0014 (rbsK)
Enzymes [BR:eca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     ECA0014 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
14538..15464
Genome map
AA seq 308 aa AA seqDB search
MKTGKLVVLGSINADHILNLEQFPRPGETVIGEQYSVAFGGKGANQAVAAGRSGANIAFI
ACVGEDDIGSRICQQLSKDNIDVSAVEAISGETTGVALIFVNAEAENMIAINAGANAAVT
PDYLHRHQQHIIDASALLMQLESPLETVIAAARLAHEHQTKVILNPAPARELPDELLSLV
DMITPNETEAQLLTEITVETEEDAARAAQVLHDKGIETVLITLGSRGVWLSESGQGQRIP
GYRVKAVDTIAAGDTFNGALVTALLENQPMSSAVKFAHAAAAISVTRRGAQPSVPWREEI
DAFLQAQE
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgggtaagctggtggtgctgggcagtattaatgctgaccatattctcaatctt
gagcaatttccccgcccaggcgaaacggtgatcggtgaacaatatagtgtcgctttcggt
ggaaaaggcgctaatcaggccgttgccgcaggccgaagtggtgcgaatatcgcctttatt
gcctgcgttggagaagatgatatcggctcccgtatttgtcagcagctatccaaggacaat
attgatgtttctgccgttgaggctatctccggggaaacgaccggcgttgcgctgattttt
gttaacgctgaagctgagaacatgatcgcgattaacgcaggcgcgaatgcggctgtgacg
cctgattatcttcatcgtcatcagcaacacattattgatgcttccgcgttgctgatgcag
cttgagtcgccgttggaaaccgttatcgccgcagccagactagcgcatgaacaccaaaca
aaggtgattcttaaccccgcccccgctcgtgaactgcccgatgaactgttatcgctggtc
gatatgatcacgccgaatgagaccgaagcgcagttgcttacggagattaccgttgagaca
gaagaggatgccgctcgcgcagcacaggttcttcacgacaaaggtatcgaaacggttctg
attacattgggtagccgtggcgtatggttgagtgaaagcggtcaagggcaacgtattccg
ggttatcgcgtaaaagccgtggacacgatcgctgccggagacacctttaatggtgcgttg
gttaccgcgctgttggaaaaccaaccaatgtcttccgctgtgaaattcgctcatgctgcg
gcagcgatttctgtaactcgccgaggcgctcaaccttctgtcccatggcgtgaagagatc
gacgcatttttgcaagctcaggagtga

DBGET integrated database retrieval system