KEGG   Pectobacterium atrosepticum: ECA0040Help
Entry
ECA0040           CDS       T00186                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
eca  Pectobacterium atrosepticum
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:eca00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(50333..50956)
Genome map
AA seq 207 aa AA seqDB search
MAQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSISHTTRAKRPGENHGEHYFFVEAD
EFKRMIQDSEFLEHAEVFGNYYGTSRPAIEQVLATGVDVFLDIDWQGAQQIRAKMPQARS
IFILPPSKEELARRLRGRGQDSDEVIARRMSQAVAEMTHYGEYDYLIVNDDFDLALLDLK
TIIRAERLRLSRQKIRHDALITKLLAD
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaggcacgttatatatcgtttctgctcccagtggggccgggaagtccagcctg
attcaggcattattaaaaactcagccgctttacgacactcaggtatcaatttcgcatacc
acacgcgctaaacgaccgggagaaaaccacggcgaacactatttcttcgtcgaagctgat
gaattcaagcgtatgattcaggatagtgagtttctggagcacgctgaagtcttcggtaat
tactacggtacatcccgaccggcaattgagcaggtattagcgacaggcgttgatgttttt
ctggatatcgactggcaaggtgcccagcaaatccgcgccaaaatgccgcaagcgcgcagt
attttcattctgccgccgtcaaaagaagaattggctcgccgtctgcgtggccgtgggcaa
gacagcgatgaagtcattgcccgccgtatgtcgcaggccgtggctgaaatgacgcattac
ggcgagtatgattacctgattgtgaatgatgatttcgatctggcgctgctcgatctgaaa
accattattcgcgccgaacgtctgcgcttgagcagacaaaagattcggcatgatgcatta
atcaccaaactattggcagactga

DBGET integrated database retrieval system