KEGG   Pectobacterium atrosepticum SCRI1043: ECA0107Help
Entry
ECA0107           CDS       T00186                                 

Gene name
pmeB
Definition
pectin methylesterase (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
eca  Pectobacterium atrosepticum SCRI1043
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eca00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ECA0107 (pmeB)
   00500 Starch and sucrose metabolism
    ECA0107 (pmeB)
Enzymes [BR:eca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     ECA0107 (pmeB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(127317..128513)
Genome map
AA seq 398 aa AA seqDB search
MKKTTYPGTVSRPILSAQEADRFTLPDYFTLRGHDGHADVWQPAPIEVDPATPWVVGPQV
GVDGATYANIQQAVNAALQAQQGRAHIDIKVLPGSYIGTVYLPADSPPLTLFGAGEQPDN
VVIQLALDSMFSPATYQKTVNPHGEYQPGDPAWYMYDLCASKQNATIDTLCAAVVWSQSD
NFQMKNLTVVNSLLDSVDSRAHQAVALRTDGDKVQLERVRLIGRQDTFFVNTSNLHNEYV
TDRYSRVYIKDSYIEGDVDYVFGRATAVFNRVHFHTVSSRGAKDIHVFAPDSMPWVQYGF
LAVKCRFTGDEGFSRERKAKLGRAWDQGARQTGYQPGLTANGQLVIRDSTIDASYDREQP
WGAAATTARPFVGNTDSARNLDDMHFNRLWEYNNIDKA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacgacataccccggcacagtttctcgccctattctttccgcgcaggaagcg
gatcgcttcacgctcccggactattttacgttgcgtggacacgatggtcatgctgatgtc
tggcaacccgcaccgattgaggtcgatccggcgacgccttgggttgttgggccacaggtc
ggggtcgatggcgcaacatacgccaacatccagcaggcggtgaacgccgcgctgcaggct
cagcagggtcgggcgcacattgatattaaagtgctgccgggcagctatatcggcacggtc
tacctccccgccgattcgccaccgctcacgctatttggcgcaggagaacaaccggataac
gtggtgattcaactcgcgctggattcgatgttttcaccagcaacttaccaaaaaacagtg
aacccgcacggtgaatatcagcccggcgatcctgcctggtacatgtacgatctctgtgcg
tcaaagcagaacgcgacgattgatactctctgtgccgccgtggtctggtcgcagagcgac
aatttccagatgaagaacctgacggtggtaaattccttgctcgattcggtagatagccgc
gcacatcaggccgtggcgctacgcaccgacggcgacaaagtgcagcttgaaagagttcgt
ctgatcgggcgtcaggatacatttttcgtcaataccagcaatctccacaacgagtacgtc
acggaccgctatagccgcgtctacattaaagacagctacattgaaggcgatgttgattac
gtttttgggcgggcgactgcggtattcaatcgcgtccactttcataccgtttccagccgt
ggggcaaaagatattcatgtttttgcacctgacagcatgccatgggtgcagtatgggttt
ttggcagtgaaatgtcgctttacgggtgatgaaggcttcagtagggaaagaaaggccaaa
ttggggcgcgcctgggatcaaggggcaaggcaaacgggatatcagccgggtctgacagca
aacggtcagctagtgattcgcgatagcacgattgacgccagctatgacagagaacaaccg
tggggagccgctgccaccaccgccagaccttttgtaggtaacacggattcggcccgcaat
ctggacgatatgcatttcaatcggctgtgggaatataacaatattgacaaagcatga

DBGET integrated database retrieval system