KEGG   Pectobacterium atrosepticum SCRI1043: ECA0208Help
Entry
ECA0208           CDS       T00186                                 

Gene name
fadB
Definition
(GenBank) fatty oxidation complex alpha subunit [includes: enoyl-CoA hydratase; delta(3)-cis-delta(2)-trans-enoyl-CoA isomerase; 3-hydroxyacyl-CoA dehydrogenase; 3-hydroxybutyryl-CoA epimerase]
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
eca  Pectobacterium atrosepticum SCRI1043
Pathway
eca00071  Fatty acid degradation
eca00280  Valine, leucine and isoleucine degradation
eca00281  Geraniol degradation
eca00310  Lysine degradation
eca00362  Benzoate degradation
eca00380  Tryptophan metabolism
eca00410  beta-Alanine metabolism
eca00640  Propanoate metabolism
eca00650  Butanoate metabolism
eca00903  Limonene and pinene degradation
eca00930  Caprolactam degradation
eca01040  Biosynthesis of unsaturated fatty acids
eca01100  Metabolic pathways
eca01110  Biosynthesis of secondary metabolites
eca01120  Microbial metabolism in diverse environments
eca01130  Biosynthesis of antibiotics
eca01200  Carbon metabolism
eca01212  Fatty acid metabolism
Module
eca_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:eca00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ECA0208 (fadB)
   00650 Butanoate metabolism
    ECA0208 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    ECA0208 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    ECA0208 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ECA0208 (fadB)
   00310 Lysine degradation
    ECA0208 (fadB)
   00380 Tryptophan metabolism
    ECA0208 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ECA0208 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ECA0208 (fadB)
   00281 Geraniol degradation
    ECA0208 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ECA0208 (fadB)
   00930 Caprolactam degradation
    ECA0208 (fadB)
Enzymes [BR:eca01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     ECA0208 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ECA0208 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     ECA0208 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     ECA0208 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 Osmo_MPGsynth
Motif
Other DBs
NCBI-ProteinID: CAG73127
GeneDB: ECA0208
UniProt: Q6DAP5
Position
complement(233861..236050)
Genome map
AA seq 729 aa AA seqDB search
MLYQGESLYLNWLEDGIAELVFSAPGSVNTLDTRTVASLGKALDVLAEQPNLKGLLLRSD
KPAFIVGADITEFLSLFAAPAEKLHEWLVFANSIFNRLEDLPVPTLSAINSYALGGGCEC
VLATDFRLATPDARIGLPETKLGIMPGFGGTVRLPRLLGADSALEIIAAGKDVSAADALK
VGLVQAVVANEKLIPAAIKMLKQAINGELDWLGYRRPKLEALKLNKIEAMMSFTTAKAMV
LQTAGKHYPAPMLAVKTIEAAATMTRDEALQLETQHFVQLARSNEARALVGIFLNDQYVK
GKAKKLVGETPVPQQAAVLGAGIMGGGIAYQSAFKGVPIRMKDINEKPLALGMNEAAKLL
NKQMERGKLDGMKMATILANIHPTLDYAGFERTDIVVEAVVENPKIKASVLAETESHISE
STILASNTSTIPIAVLAAALKRPQNFCGMHFFNPVHRMPLVEIIRGPKTSDSTIASVVAY
ASKMGKTPIVVNDCPGFFVNRVLFPYFAAFSLLLRDGADFREIDNAMEKKFGWPMGPAYL
LDVVGIDTAHHAQAVMAEGFPQRMAKDYRDAIDVLFEHQRFGQKNGQGFYRYQTDSKGKQ
RKEQDDAVDALLKNISQPKKAFSAEEIIARMMIPMINEVARCLEEGIVASPAEADMALVY
GLGFPPFHGGACRYLDTLGSERYVEMAQQLAHLGAIYQVPDGLQQKARSNEGYYPSVAPH
ADVSHGQPA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctttatcaaggtgaatccctctaccttaactggcttgaggacggcattgccgagctg
gtattttctgcccctggctccgtaaacacgctagatacccgcacggttgccagcctgggt
aaggcgctggacgttctggcggaacagccgaacctgaagggcttactgctgcgatcagac
aaacctgcatttattgtcggtgccgatatcacggaattcctttctctttttgccgcgccg
gccgaaaagctgcatgagtggcttgtcttcgccaacagcattttcaaccgtcttgaggat
ttacccgttcccacgctgtccgcgattaatagctatgcgctgggaggcggatgtgaatgc
gtgctggcgaccgattttcgcttagcgacgccagatgcacgaatcgggttgcctgagact
aaactcggaatcatgccgggctttggcggcacagtcaggctaccgcgtctgttaggtgca
gacagcgcgctggagattatcgccgcaggtaaagacgtcagcgcagccgatgctttaaaa
gtggggctggtgcaggctgttgtcgctaatgaaaaactgattcccgccgccatcaagatg
ctaaagcaggccataaatggcgagctggactggctgggttaccgacgcccgaaacttgag
gcgctgaagctcaataaaattgaagccatgatgagctttaccaccgccaaagcgatggtg
ctacaaaccgcggggaaacattatccagcgccgatgttagcggtaaaaaccatcgaagcc
gccgcaaccatgacacgtgatgaggcattgcagctcgaaacgcagcacttcgttcaactg
gcgcgttcaaatgaagctcgcgccctcgtcggcattttcctcaacgatcaatatgttaaa
ggcaaagcgaagaagctggttggcgagacacctgtaccgcaacaggccgctgtgctgggt
gcgggcattatgggcggcggaattgcctatcaatccgcgttcaaaggcgtgccaattcgg
atgaaggatatcaacgagaagccactcgcgctggggatgaacgaggcagctaagctcctg
aataaacagatggagcgaggcaaactagacggaatgaaaatggcgacgattttggcaaac
attcacccgacgctggattacgccgggtttgaacgtaccgatatcgtcgttgaagctgtg
gtagaaaacccgaaaatcaaagcgagcgtattagcagaaaccgaatcgcacattagcgag
agcacgattctcgcttctaatacctcaacgattccaattgctgtgctggctgcggcgtta
aaacgaccgcaaaatttctgcggtatgcacttctttaacccagtacaccgtatgccgctg
gtcgaaattattcgcggccctaaaactagtgacagtaccatcgccagcgtagtggcctac
gccagcaaaatgggcaagacaccaattgtcgtgaacgactgccctggtttcttcgtgaat
cgcgttctgtttccctactttgcagccttcagtttactactcagagacggtgccgatttc
cgcgagatcgataacgccatggagaagaaattcggttggccgatggggccagcctatctg
ctggacgttgtcggcattgataccgctcaccatgcacaagccgtgatggcagaaggcttt
ccacagcggatggcaaaagactatcgcgatgcgatcgacgtgttgtttgaacatcagcgc
tttgggcagaaaaatggtcagggtttctatcgttatcaaaccgatagcaaagggaagcag
cgtaaagaacaggatgacgccgtagatgcactccttaaaaacatcagccaaccgaaaaaa
gcgttcagcgcagaagagattatcgctcggatgatgatcccgatgattaatgaagtcgcg
cgctgtctggaagaaggtatcgtcgccagccctgccgaagcggacatggcgctggtatat
ggattaggtttccctcccttccacggcggagcctgccgctatttggatacgttgggcagc
gagcgttatgtcgagatggcgcagcagttggctcacctcggcgccatctatcaggtgcct
gacggcttacagcaaaaagccagaagcaatgaaggctattacccatcggtcgcgccacac
gcggacgtttcccacggtcaaccggcatga

DBGET integrated database retrieval system