KEGG   Pectobacterium atrosepticum: ECA0301Help
Entry
ECA0301           CDS       T00186                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
eca  Pectobacterium atrosepticum
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:eca00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:eca00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
345980..347242
Genome map
AA seq 420 aa AA seqDB search
MDKFRVQGPTRLAGEVTISGAKNAALPILFAALLAEEPVEIQNVPKLRDIDTTMKLLGQL
GARVERNGSVHVDASDVNVFCAPYDLVKTMRASIWALGPLVARFGQGQVSLPGGCAIGAR
PVDLHIYGLEQLGAQIVLEEGYVKATVDGRLKGAHIVMDKVSVGATVTIMSAATLAEGTT
IIENAAREPEIVDTANFLNTLGAKISGAGSDKITIEGVARLGGGVYRVVPDRIETGTFLV
AAAVSRGQIICRNTRPDTLDAVLAKLREAGADIEVGEDWISLDMHGKRPKAVTFRTSPHP
GFPTDMQAQFSLLNLVAEGTGVITETIFENRFMHVPELIRMGAQAEIESNTVICHGVDKL
SGAQVMATDLRASASLVLAGCIAEGVTTVDRIYHIDRGYDRIEDKLRALGANIERVKEHE
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggataaatttcgtgttcagggcccaacccgcttggcgggggaagtgactatttccggc
gccaagaatgctgcgttgccaatcctgtttgctgcgttactcgcagaggaaccggtagag
attcagaacgtaccgaaactgcgtgacattgataccaccatgaagctgcttggtcagttg
ggtgcgcgcgttgagcgtaacggttccgtccacgtggatgccagcgatgtaaacgtgttt
tgcgcgccgtacgacttggtgaaaaccatgcgtgcctccatctgggctttagggccactg
gtggcacggtttgggcaaggacaggtatcgctgcccggcggctgtgcgattggcgcgcgc
ccggtagatttgcatatttacggccttgagcagctcggcgcgcagatcgtactggaagaa
ggatatgtaaaagcaacggttgatggtcgcctgaaaggcgcgcatatcgtgatggataag
gtgagtgtgggtgccacggtaaccatcatgagtgcggcaacgctggcggaaggcaccacg
attattgagaacgccgcgcgtgagccggagattgtcgatacggcaaactttctgaatacg
ctgggtgcgaaaatcagcggtgcaggcagcgataaaatcactattgaaggcgtcgcgcgt
ctgggcggcggcgtgtatcgcgttgtgcctgaccgtattgaaaccgggacattcctggtt
gcggctgcggtatcacgcggtcagattatctgccgcaatacccgtcctgatacgctggat
gcggtattagctaagctgcgcgaagcgggcgcggatatcgaagtcggcgaagactggatt
agcctggatatgcacggtaagcgtccgaaagcagttacctttcgcacgtcgccgcatcct
ggattcccgaccgatatgcaggcgcagttcagcctgctgaatctggtcgcggaaggtaca
ggtgtgattaccgaaactatttttgaaaaccgcttcatgcatgtgcctgagcttatccgt
atgggcgcacaggcggagattgagagcaatacggtgatttgccacggcgtagataagctg
tcgggtgcgcaggtgatggcgaccgacttacgtgcgtcggccagtctggtgttagccggt
tgtatcgcggaaggtgtgacgacagtggatcgtatttatcatatcgatcgtggctatgac
cgtatcgaagataagctgcgtgcattaggtgcgaacatcgagcgtgttaaagagcacgag
taa

DBGET integrated database retrieval system