KEGG   Pectobacterium atrosepticum: ECA0403Help
Entry
ECA0403           CDS       T00186                                 

Gene name
holC
Definition
DNA polymerase III subunit chi (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
eca  Pectobacterium atrosepticum
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:eca00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ECA0403 (holC)
   00240 Pyrimidine metabolism
    ECA0403 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    ECA0403 (holC)
   03430 Mismatch repair
    ECA0403 (holC)
   03440 Homologous recombination
    ECA0403 (holC)
Enzymes [BR:eca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     ECA0403 (holC)
DNA replication proteins [BR:eca03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     ECA0403 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(460923..461372)
Genome map
AA seq 149 aa AA seqDB search
MKNATFYLLEHDSKSGELSAHEALACDLAAERWRAGKRVLIVCEDEQQAIRLDEALWQRD
PNAFVPHNLAGEGPRHGAPVELAWPQRRGNAPRDLLISLLPQFADFATAFHEVIDFVPYE
DSLKQLARDRYKTYRSVGFRLTTATPPTH
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgcaacgttctatcttctcgaacacgacagcaaaagcggtgagctcagcgcc
catgaggcactggcatgcgatctggcggcagaacgttggcgagcaggaaagcgcgtgctg
attgtctgcgaggacgaacagcaggccattaggcttgacgaggcgctgtggcaaagagac
cccaacgcattcgttccgcataatctggcaggcgaagggccgcgtcacggcgcaccggtc
gaactggcatggccacagcggcgtggcaatgcgccacgggacctgttgatcagcctattg
ccgcagttcgcagattttgccaccgctttccatgaagtgatagactttgtcccttacgaa
gactccttgaaacagttggcgcgcgaccgctataaaacctatcgcagcgtcggcttccga
ttgaccacggctacgccgccaactcactga

DBGET integrated database retrieval system