KEGG   Pectobacterium atrosepticum SCRI1043: ECA0403Help
Entry
ECA0403           CDS       T00186                                 

Gene name
holC
Definition
(GenBank) DNA polymerase III, chi subunit
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
eca  Pectobacterium atrosepticum SCRI1043
Pathway
eca00230  Purine metabolism
eca00240  Pyrimidine metabolism
eca01100  Metabolic pathways
eca03030  DNA replication
eca03430  Mismatch repair
eca03440  Homologous recombination
Module
eca_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:eca00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ECA0403 (holC)
   00240 Pyrimidine metabolism
    ECA0403 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    ECA0403 (holC)
   03430 Mismatch repair
    ECA0403 (holC)
   03440 Homologous recombination
    ECA0403 (holC)
Enzymes [BR:eca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     ECA0403 (holC)
DNA replication proteins [BR:eca03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     ECA0403 (holC)
DNA repair and recombination proteins [BR:eca03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     ECA0403 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi
Motif
Other DBs
NCBI-ProteinID: CAG73322
GeneDB: ECA0403
UniProt: Q6DA53
Position
complement(460923..461372)
Genome map
AA seq 149 aa AA seqDB search
MKNATFYLLEHDSKSGELSAHEALACDLAAERWRAGKRVLIVCEDEQQAIRLDEALWQRD
PNAFVPHNLAGEGPRHGAPVELAWPQRRGNAPRDLLISLLPQFADFATAFHEVIDFVPYE
DSLKQLARDRYKTYRSVGFRLTTATPPTH
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgcaacgttctatcttctcgaacacgacagcaaaagcggtgagctcagcgcc
catgaggcactggcatgcgatctggcggcagaacgttggcgagcaggaaagcgcgtgctg
attgtctgcgaggacgaacagcaggccattaggcttgacgaggcgctgtggcaaagagac
cccaacgcattcgttccgcataatctggcaggcgaagggccgcgtcacggcgcaccggtc
gaactggcatggccacagcggcgtggcaatgcgccacgggacctgttgatcagcctattg
ccgcagttcgcagattttgccaccgctttccatgaagtgatagactttgtcccttacgaa
gactccttgaaacagttggcgcgcgaccgctataaaacctatcgcagcgtcggcttccga
ttgaccacggctacgccgccaactcactga

DBGET integrated database retrieval system