KEGG   Pectobacterium atrosepticum SCRI1043: ECA0728Help
Entry
ECA0728           CDS       T00186                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
eca  Pectobacterium atrosepticum SCRI1043
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eca00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    ECA0728 (deoA)
Enzymes [BR:eca01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     ECA0728 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
795852..797180
Genome map
AA seq 442 aa AA seqDB search
MFLIQEIIRKKRDGKTLSEEEIRFFINGIRDNTVSEGQIAALAMTIYFHDMSMDERVALT
LAMRDSGTVLNWKSLNLNGPLVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLEAIPGLDIFPNDDHFRRIIQQVGVAIIGQTSSLAPADKRFYATRDITATVDSI
PLITASILAKKLAEGLDALVMDVKVGSGAFMPTYELSEQLAQAIVGVANNAGCRTSALLT
DMNQVLASSAGNALEVREAVRFLTGESRNPRLYDVTMALCGEMLLAGGLASSADDAHSRL
QAVLDNGKAADVFGRMVAAQRGPGDFVEHYDRYLPVATLSKPVFATREGVVTAMDTRALG
MAVVSLGGGRRQASDTIDYSVGLDSMISLGERVDAQRPLAVIHANTEAQWQQAANEVRAA
IQLGDTAPEKTPMVYRRVSAEA
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
ttgtttctgattcaagaaattattcgtaagaagcgtgatggaaaaactctgagcgaagag
gagatccgcttttttatcaacggtattcgtgacaataccgtctctgaaggtcagattgcc
gctctggcgatgaccatttactttcacgatatgtcgatggatgaacgcgtggcgctgacg
ttggcgatgcgtgactccggtacggtgctgaactggaagagcctgaatctgaacggcccg
ctggtggacaaacactctaccggtggtgtgggggatgtcacctcgctgatgctggggccg
atggtcgccgcctgtgggggctacgtcccgatgatctctgggcgtgggctgggacatacc
ggcggcacgctggataaacttgaagcgattccgggactggatattttcccgaacgatgac
cattttcgtcgcatcatccagcaggttggcgtcgcgattattgggcagacctcatcgctg
gcgccggcggataaacgtttttacgctacgcgcgacattaccgctacggtcgattcgatc
ccactgatcactgcgtcgattctggcgaagaagctggctgaagggctggatgcgttagtg
atggacgtgaaagtaggttctggggcgtttatgccgacctatgaactgtccgaacagctg
gcgcaggcgattgtcggcgtggcaaataacgcaggatgccgcaccagcgcattactgacg
gacatgaatcaggtgctggcatccagtgcgggtaatgcgctggaagtgcgggaggccgtg
cgtttcctgacaggggagagccgcaacccacgcctgtatgatgttactatggcgctatgt
ggcgagatgctgctggcgggtggactggcaagctcggcggacgacgcgcattcgcgtttg
caggccgtgttggataacggcaaagccgccgacgtcttcgggcgcatggtcgccgcacag
cgtggaccgggtgattttgtcgaacactacgatcgttacctgccggtggcgacgttaagt
aagccggtgttcgcgacgcgtgaaggcgttgtgaccgcgatggatacccgtgcgttgggc
atggcggtcgtgtcgctgggcggcggacgccgtcaggcctcggatacgatcgattacagt
gtcggtctggatagcatgattagcctgggtgagcgcgttgacgcgcagcgcccgctggcg
gtcatccacgccaatacggaagcacaatggcagcaggcggcgaatgaagtccgagccgcg
atccaactgggcgacacggcaccagaaaagaccccgatggtctatcgtcgggtgagtgcg
gaggcgtga

DBGET integrated database retrieval system