KEGG   Pectobacterium atrosepticum SCRI1043: ECA0734Help
Entry
ECA0734           CDS       T00186                                 

Gene name
holD
Definition
(GenBank) DNA polymerase III, psi subunit
  KO
K02344  DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
eca  Pectobacterium atrosepticum SCRI1043
Pathway
eca00230  Purine metabolism
eca00240  Pyrimidine metabolism
eca01100  Metabolic pathways
eca03030  DNA replication
eca03430  Mismatch repair
eca03440  Homologous recombination
Module
eca_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:eca00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ECA0734 (holD)
   00240 Pyrimidine metabolism
    ECA0734 (holD)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    ECA0734 (holD)
   03430 Mismatch repair
    ECA0734 (holD)
   03440 Homologous recombination
    ECA0734 (holD)
Enzymes [BR:eca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     ECA0734 (holD)
DNA replication proteins [BR:eca03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     ECA0734 (holD)
DNA repair and recombination proteins [BR:eca03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     ECA0734 (holD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_III_psi CSTF_C
Motif
Other DBs
NCBI-ProteinID: CAG73648
GeneDB: ECA0734
UniProt: Q6D985
Position
complement(802996..803427)
Genome map
AA seq 143 aa AA seqDB search
MESRRDRLLQQLGITQWTLRRPTVLQGEIAVSLPDQVRLVIVSAEPLADDEPLLADVLHS
LALTPAQAYRLTPQQIEMLPADARCHSWRLGIAEPIALQGIQLSSPLLSELYQNADAKRA
LWQQICEHEHDIFSDASRSGTSL
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggaatcaagacgtgacaggctgctacagcaactggggattacgcagtggacgctgcgt
cgcccgacggtgctgcaaggcgaaatcgccgtcagtctgcccgatcaggtgcgtctggtg
atcgtctccgccgaaccgctggccgatgatgaaccgctgctggccgacgttctgcacagt
cttgcgctcacccctgcgcaagcctaccgcctgacgccgcagcagatagagatgttgccc
gccgatgcacgctgccatagctggcggctgggcatcgcggagcccattgcgctacagggc
atccagctttccagccctctgctttctgaactttatcaaaatgccgacgccaaacgggcg
ctgtggcaacagatctgtgaacatgaacacgatatcttctctgacgccagccgatctggc
acaagcctttaa

DBGET integrated database retrieval system