KEGG   Pectobacterium atrosepticum: ECA0734Help
Entry
ECA0734           CDS       T00186                                 

Gene name
holD
Definition
DNA polymerase III subunit psi (EC:2.7.7.7)
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
eca  Pectobacterium atrosepticum
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:eca00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ECA0734 (holD)
   00240 Pyrimidine metabolism
    ECA0734 (holD)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    ECA0734 (holD)
   03430 Mismatch repair
    ECA0734 (holD)
   03440 Homologous recombination
    ECA0734 (holD)
Enzymes [BR:eca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     ECA0734 (holD)
DNA replication proteins [BR:eca03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     ECA0734 (holD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(802996..803427)
Genome map
AA seq 143 aa AA seqDB search
MESRRDRLLQQLGITQWTLRRPTVLQGEIAVSLPDQVRLVIVSAEPLADDEPLLADVLHS
LALTPAQAYRLTPQQIEMLPADARCHSWRLGIAEPIALQGIQLSSPLLSELYQNADAKRA
LWQQICEHEHDIFSDASRSGTSL
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggaatcaagacgtgacaggctgctacagcaactggggattacgcagtggacgctgcgt
cgcccgacggtgctgcaaggcgaaatcgccgtcagtctgcccgatcaggtgcgtctggtg
atcgtctccgccgaaccgctggccgatgatgaaccgctgctggccgacgttctgcacagt
cttgcgctcacccctgcgcaagcctaccgcctgacgccgcagcagatagagatgttgccc
gccgatgcacgctgccatagctggcggctgggcatcgcggagcccattgcgctacagggc
atccagctttccagccctctgctttctgaactttatcaaaatgccgacgccaaacgggcg
ctgtggcaacagatctgtgaacatgaacacgatatcttctctgacgccagccgatctggc
acaagcctttaa

DBGET integrated database retrieval system