KEGG   Pectobacterium atrosepticum SCRI1043: ECA0996Help
Entry
ECA0996           CDS       T00186                                 

Gene name
recD
Definition
exonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
eca  Pectobacterium atrosepticum SCRI1043
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:eca00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ECA0996 (recD)
Enzymes [BR:eca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     ECA0996 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1113509..1115371
Genome map
AA seq 620 aa AA seqDB search
MIALLEMAQVQRLLRALDIQFARMLADDTQPELLLAAACLSAHSGAGHVCLPLENLQAQT
LFDGREPELAQQLITESGINTVAAWQQRLLASDAVSDGSKPTPLVLQGEKLYLQRSWQSE
GRVAQFIASERDTVSVDEPAIRAVLDRLFPETGEAIDWQKVAAAVALTRRIAVISGGPGT
GKTTTVAKLLAALIELNTGEALRIQLAAPTGKAAARLTESLGLALHRLAVDQRQRDAFPK
EATTLHRLLGAVTDSQRLRHHQGNPLHLDVLIVDEASMVDLPMMANVIAALPAQARIIFL
GDRDQLASVEAGAVLGDICRFAEAGYSRARAQQLQRLTGCALDESGPEGQTTVSDSICLL
RRSYRFDPHSGIGQLALAVNGGDDARVRAVLNGEFADITCSPLAEAEEYQAMLAQCVEGY
RDYLDLIAAGATPDAVLHAFQRYRQLCALREGPFGVAGLNQRIEQALHQSGLIQRSRNPL
NRWYPGRPVMIGRNDAALGLFNGDIGIAMMGGNGELRVFFPLPNGETKDVTPSRLPPHET
AYAMTVHKSQGSEFDHTALVLPNHYLPVLTRELVYTAITRARQRLSLYTDVRILCRAVKT
PTQRYSGLEERISAFINGTR
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgattgccttgcttgaaatggcgcaggtgcagcggttgctgcgcgctctggatatccag
tttgccagaatgttggcagatgatacgcagcctgaactgctgttggcggccgcctgtctg
agtgcacattcgggcgcggggcacgtgtgtctaccgttggagaacttgcaggcgcagacg
ctatttgacggtcgtgaacctgaacttgcgcaacagttgatcaccgagtcagggatcaac
acggttgctgcttggcagcaacgtttgctggcgtccgatgccgtaagcgacggtagcaaa
cctacgcctctggtgctgcaaggcgaaaaactttatttacagcgtagctggcagagtgaa
gggcgcgtggcgcagtttatcgccagcgagcgtgatacggtgtcggtcgatgaacctgcg
attcgggcggtgctggatcggctgtttcctgagacgggcgaggcaatagactggcagaaa
gtggctgccgctgttgccctgacgcgccgtattgcggttatttccggcggtccggggacg
gggaaaacgacgacagttgccaagctgctggcggcgctgattgagctgaatacgggggag
gcgttacgtattcaattagctgcgcctaccggaaaggcagccgcgcggctaacggagtcg
ctggggctggcattgcaccgtctggcggtggatcaacggcagagagacgcgtttccgaag
gaagcgacaacgctgcatcgccttttaggcgcggtaacggatagccagcggttgcgtcac
catcagggaaatccgcttcatctggatgtgctgattgtggatgaggcttcgatggtcgat
ttgccgatgatggcgaatgtgatcgccgcacttccggcacaggccagaattatctttctg
ggcgatcgcgatcagctggcgtccgtcgaggcgggggcagtgttaggtgacatctgtcgt
tttgctgaggctggctatagccgtgcgcgggcgcaacagttgcagcggttaacgggctgc
gcactggatgagagcggcccggaaggacagacgacggtcagtgacagtatttgtctgtta
cgccggagctatcgtttcgatccacattccggtattgggcaactggcgctggcggtgaac
ggcggcgatgatgcccgcgtgcgtgcggtgctgaacggcgagtttgctgatatcacctgt
agcccgttagccgaggctgaagagtatcaggcgatgctggcacagtgcgtcgaaggctat
cgtgattatctcgatcttattgcagcgggagcgacaccggatgctgtgctgcatgctttc
cagcgttatcgccaactgtgtgcgttgcgcgaagggccgtttggcgtagcgggactcaat
cagcgcattgagcaggctttgcatcagtctgggctgattcagcgtagtcgcaacccactt
aaccgctggtatcccggtcgaccggtgatgattggacgtaatgatgccgcattgggtctg
ttcaatggcgatattggtatcgctatgatggggggaaatggggaactgcgcgtgtttttc
cccttgccgaatggcgaaaccaaagatgttacgccaagccgtctgccgccgcatgaaacg
gcttatgcgatgacggtgcataaatcgcagggatcggagttcgatcatactgcgctggtg
ctgccgaaccactatttacccgtgctgacgcgggagttggtgtataccgccatcacgcgt
gcgcgccagcgtttgtcgctctataccgatgtccgaattctctgtcgggcggtgaaaacg
ccaacgcagcgctatagcgggttggaagagagaattagcgcgttcattaatggaacgcgg
tag

DBGET integrated database retrieval system