KEGG   Pectobacterium atrosepticum SCRI1043: ECA1358Help
Entry
ECA1358           CDS       T00186                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
eca  Pectobacterium atrosepticum SCRI1043
Pathway
eca00020  Citrate cycle (TCA cycle)
eca00190  Oxidative phosphorylation
eca00650  Butanoate metabolism
eca01100  Metabolic pathways
eca01110  Biosynthesis of secondary metabolites
eca01120  Microbial metabolism in diverse environments
eca01130  Biosynthesis of antibiotics
eca01200  Carbon metabolism
Module
eca_M00009  Citrate cycle (TCA cycle, Krebs cycle)
eca_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
eca_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:eca00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ECA1358 (sdhD)
   00650 Butanoate metabolism
    ECA1358 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    ECA1358 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: CAG74268
GeneDB: ECA1358
UniProt: Q6D7G7
Position
1537390..1537737
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDWLLIRASAIVIVLYVIYLIGFIATAGDITYEIWRGFFAMALTKVF
TLLTLFSILVHAWIGMWQVLTDYIKPLALRLTLQLAIVIALLVYVIYGTIVVWGA
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaatgcttctgcgttaggacgcaatggcgtacacgattggttactgattcgc
gcttccgccatcgtcattgttctatatgtaatttatctcattggctttattgctacggct
ggcgacatcacttatgaaatctggcgtggtttcttcgcgatggctctcaccaaagtattc
acactgctaaccttattttccattctggttcatgcctggatagggatgtggcaagtgctg
accgactacattaaaccgctggccttacgcctgactttacagttggcgattgttatagcg
ctgttggtgtacgtcatttatggaactattgtggtgtggggtgcgtga

DBGET integrated database retrieval system