KEGG   Pectobacterium atrosepticum: ECA1358Help
Entry
ECA1358           CDS       T00186                                 

Gene name
sdhD
Definition
succinate dehydrogenase cytochrome b556 small membrane subunit (EC:1.3.5.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
eca  Pectobacterium atrosepticum
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:eca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ECA1358 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ECA1358 (sdhD)
   00650 Butanoate metabolism
    ECA1358 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    ECA1358 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1537390..1537737
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDWLLIRASAIVIVLYVIYLIGFIATAGDITYEIWRGFFAMALTKVF
TLLTLFSILVHAWIGMWQVLTDYIKPLALRLTLQLAIVIALLVYVIYGTIVVWGA
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaatgcttctgcgttaggacgcaatggcgtacacgattggttactgattcgc
gcttccgccatcgtcattgttctatatgtaatttatctcattggctttattgctacggct
ggcgacatcacttatgaaatctggcgtggtttcttcgcgatggctctcaccaaagtattc
acactgctaaccttattttccattctggttcatgcctggatagggatgtggcaagtgctg
accgactacattaaaccgctggccttacgcctgactttacagttggcgattgttatagcg
ctgttggtgtacgtcatttatggaactattgtggtgtggggtgcgtga

DBGET integrated database retrieval system